Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T608

Protein Details
Accession A0A0L0T608    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-25YVPETFTQKLKRKCKEEPLVPIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, pero 2, cyto 1, plas 1, extr 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007667  Hypoxia_induced_domain  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04588  HIG_1_N  
PROSITE View protein in PROSITE  
PS51503  HIG1  
Amino Acid Sequences MPYYVPETFTQKLKRKCKEEPLVPIGMGLTVFALFKGVSAFRSGDQKTSQQMMRWRVAAQGFTLIAATAGMLYYSNKPKPDPNVIPANAVPLFPPTTTSSSSSNPPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.78
4 0.81
5 0.82
6 0.8
7 0.79
8 0.75
9 0.67
10 0.59
11 0.51
12 0.4
13 0.29
14 0.21
15 0.12
16 0.06
17 0.04
18 0.04
19 0.04
20 0.05
21 0.04
22 0.04
23 0.06
24 0.06
25 0.06
26 0.08
27 0.09
28 0.09
29 0.16
30 0.16
31 0.18
32 0.19
33 0.21
34 0.22
35 0.25
36 0.25
37 0.22
38 0.28
39 0.3
40 0.29
41 0.28
42 0.26
43 0.25
44 0.25
45 0.22
46 0.16
47 0.13
48 0.11
49 0.1
50 0.09
51 0.06
52 0.05
53 0.05
54 0.04
55 0.03
56 0.03
57 0.02
58 0.03
59 0.04
60 0.09
61 0.15
62 0.18
63 0.2
64 0.22
65 0.27
66 0.33
67 0.41
68 0.42
69 0.42
70 0.48
71 0.47
72 0.49
73 0.44
74 0.43
75 0.33
76 0.29
77 0.23
78 0.17
79 0.18
80 0.15
81 0.18
82 0.17
83 0.2
84 0.23
85 0.25
86 0.27
87 0.28
88 0.33