Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VVP8

Protein Details
Accession B2VVP8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-81NYDPVARSRLRRRGNKQLPPSRYQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002132  Ribosomal_L5  
IPR031309  Ribosomal_L5_C  
IPR022803  Ribosomal_L5_dom_sf  
IPR031310  Ribosomal_L5_N  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00281  Ribosomal_L5  
PF00673  Ribosomal_L5_C  
Amino Acid Sequences MAMRELPLRTAKAFCNTTRPAIRLVGPLCRRNASSEAVREVDASSFEVPPPSEDLVKNYDPVARSRLRRRGNKQLPPSRYQYRSPKYYRGPLHPHQPPPPSDPSSRLFQPGPFSLTRLEQTYQSKIASDLLTLTYQHYPPGYRAPKTEQRLREWTGDSPYFKNRPLRPPRGKGEVLRLLQEPRTFRNVPKITRVTLHSFVPEAQENSANLHVAGMIVQAISNVRAVSHKARHNVVGWGLRKGRYVSVTSTMEREDAEHFLAKLIDVVLPRIKEWKGVPGSSGDGHGNMSFGLTPDQVALFPEIEINYDAYPPKMIPGCYITIQTDATSNKDARVLLQAIGIPFYGKLND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.43
4 0.49
5 0.51
6 0.49
7 0.44
8 0.43
9 0.44
10 0.42
11 0.41
12 0.42
13 0.44
14 0.47
15 0.47
16 0.47
17 0.45
18 0.43
19 0.44
20 0.4
21 0.4
22 0.4
23 0.4
24 0.39
25 0.38
26 0.33
27 0.31
28 0.26
29 0.2
30 0.17
31 0.14
32 0.13
33 0.14
34 0.15
35 0.14
36 0.15
37 0.18
38 0.18
39 0.2
40 0.2
41 0.23
42 0.27
43 0.28
44 0.27
45 0.25
46 0.26
47 0.23
48 0.25
49 0.29
50 0.29
51 0.36
52 0.45
53 0.53
54 0.59
55 0.68
56 0.74
57 0.79
58 0.82
59 0.84
60 0.85
61 0.85
62 0.82
63 0.77
64 0.77
65 0.74
66 0.68
67 0.66
68 0.66
69 0.64
70 0.67
71 0.68
72 0.69
73 0.67
74 0.72
75 0.7
76 0.68
77 0.69
78 0.65
79 0.69
80 0.68
81 0.67
82 0.65
83 0.64
84 0.58
85 0.56
86 0.57
87 0.52
88 0.47
89 0.45
90 0.41
91 0.41
92 0.39
93 0.36
94 0.3
95 0.28
96 0.3
97 0.27
98 0.28
99 0.23
100 0.23
101 0.21
102 0.22
103 0.21
104 0.2
105 0.19
106 0.2
107 0.23
108 0.25
109 0.25
110 0.23
111 0.22
112 0.2
113 0.21
114 0.17
115 0.13
116 0.11
117 0.1
118 0.11
119 0.11
120 0.12
121 0.12
122 0.12
123 0.13
124 0.13
125 0.12
126 0.13
127 0.23
128 0.25
129 0.24
130 0.27
131 0.33
132 0.41
133 0.46
134 0.52
135 0.47
136 0.49
137 0.54
138 0.54
139 0.51
140 0.44
141 0.41
142 0.38
143 0.36
144 0.32
145 0.28
146 0.31
147 0.29
148 0.31
149 0.37
150 0.37
151 0.44
152 0.52
153 0.6
154 0.63
155 0.67
156 0.69
157 0.68
158 0.66
159 0.57
160 0.55
161 0.52
162 0.44
163 0.39
164 0.35
165 0.29
166 0.29
167 0.29
168 0.23
169 0.18
170 0.24
171 0.24
172 0.23
173 0.33
174 0.36
175 0.35
176 0.42
177 0.42
178 0.36
179 0.38
180 0.4
181 0.35
182 0.32
183 0.31
184 0.23
185 0.21
186 0.21
187 0.2
188 0.18
189 0.13
190 0.12
191 0.13
192 0.13
193 0.14
194 0.14
195 0.12
196 0.1
197 0.09
198 0.08
199 0.06
200 0.06
201 0.04
202 0.03
203 0.03
204 0.03
205 0.03
206 0.04
207 0.04
208 0.05
209 0.05
210 0.05
211 0.06
212 0.09
213 0.16
214 0.22
215 0.27
216 0.3
217 0.32
218 0.34
219 0.35
220 0.35
221 0.33
222 0.33
223 0.29
224 0.31
225 0.32
226 0.31
227 0.32
228 0.3
229 0.29
230 0.25
231 0.26
232 0.23
233 0.26
234 0.28
235 0.27
236 0.27
237 0.25
238 0.22
239 0.2
240 0.19
241 0.14
242 0.13
243 0.14
244 0.14
245 0.13
246 0.14
247 0.14
248 0.12
249 0.11
250 0.09
251 0.1
252 0.08
253 0.11
254 0.14
255 0.14
256 0.15
257 0.19
258 0.19
259 0.21
260 0.22
261 0.28
262 0.29
263 0.29
264 0.3
265 0.28
266 0.3
267 0.27
268 0.28
269 0.19
270 0.15
271 0.16
272 0.15
273 0.13
274 0.1
275 0.1
276 0.08
277 0.08
278 0.09
279 0.08
280 0.08
281 0.09
282 0.09
283 0.09
284 0.1
285 0.11
286 0.09
287 0.09
288 0.11
289 0.1
290 0.11
291 0.12
292 0.12
293 0.11
294 0.13
295 0.14
296 0.13
297 0.14
298 0.13
299 0.17
300 0.19
301 0.19
302 0.2
303 0.23
304 0.26
305 0.26
306 0.29
307 0.25
308 0.24
309 0.24
310 0.21
311 0.22
312 0.2
313 0.23
314 0.26
315 0.25
316 0.24
317 0.26
318 0.26
319 0.23
320 0.28
321 0.26
322 0.21
323 0.23
324 0.24
325 0.21
326 0.22
327 0.2
328 0.14
329 0.13