Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SZA7

Protein Details
Accession A0A0L0SZA7   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
108-130LSLLRVVKKWPRKRQDEWHKSLHHydrophilic
301-327QDKVDQSTLDRRRRVRRKSDAPTPEAAHydrophilic
NLS Segment(s)
PositionSequence
100-121WRAKWRRILSLLRVVKKWPRKR
312-317RRRVRR
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
Amino Acid Sequences MRRGHHRHTASGASANSTTSATSRTSRASGTAPPPPPVPEPAPSTSSSGSTSAAITAAALRKKLLVTALADEDAALGSSSTDVTGTDVHAARSAARSHGWRAKWRRILSLLRVVKKWPRKRQDEWHKSLHAAAVHSLQHSAAHSEDGGVVDGNGPRRIEDGAAAGASRGGQQTEDVAAFGSQSPGATLGAAVAPRNVVIDTPLPPPASPPAAPVTDATRAPVPADDDAPLPPPVVVVPAESATAPVLTTNDLAATTPQTDAPIEEDESLDPPMIHITLDDGFNYEAFTIERAHTVFPRRAQDKVDQSTLDRRRRVRRKSDAPTPEAAALRDKSPLHSMWSAAEEAETVVGHREAGIGAGAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.3
3 0.25
4 0.21
5 0.18
6 0.13
7 0.15
8 0.14
9 0.17
10 0.19
11 0.22
12 0.23
13 0.24
14 0.26
15 0.26
16 0.31
17 0.33
18 0.4
19 0.39
20 0.39
21 0.4
22 0.41
23 0.41
24 0.39
25 0.37
26 0.33
27 0.36
28 0.37
29 0.38
30 0.36
31 0.37
32 0.33
33 0.31
34 0.28
35 0.24
36 0.21
37 0.18
38 0.17
39 0.13
40 0.12
41 0.1
42 0.08
43 0.11
44 0.15
45 0.16
46 0.16
47 0.16
48 0.17
49 0.18
50 0.19
51 0.17
52 0.15
53 0.15
54 0.18
55 0.2
56 0.18
57 0.18
58 0.16
59 0.14
60 0.11
61 0.09
62 0.06
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.05
71 0.06
72 0.07
73 0.11
74 0.12
75 0.12
76 0.14
77 0.14
78 0.14
79 0.16
80 0.17
81 0.14
82 0.16
83 0.18
84 0.23
85 0.3
86 0.33
87 0.4
88 0.47
89 0.55
90 0.61
91 0.61
92 0.6
93 0.6
94 0.62
95 0.58
96 0.6
97 0.57
98 0.52
99 0.51
100 0.49
101 0.5
102 0.55
103 0.59
104 0.59
105 0.62
106 0.66
107 0.73
108 0.81
109 0.84
110 0.85
111 0.81
112 0.78
113 0.7
114 0.62
115 0.55
116 0.46
117 0.36
118 0.26
119 0.21
120 0.17
121 0.16
122 0.15
123 0.15
124 0.12
125 0.11
126 0.11
127 0.11
128 0.08
129 0.07
130 0.07
131 0.07
132 0.08
133 0.07
134 0.07
135 0.05
136 0.05
137 0.06
138 0.08
139 0.09
140 0.1
141 0.1
142 0.1
143 0.11
144 0.12
145 0.1
146 0.09
147 0.09
148 0.07
149 0.07
150 0.07
151 0.06
152 0.06
153 0.06
154 0.06
155 0.05
156 0.04
157 0.04
158 0.05
159 0.05
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.05
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.05
183 0.05
184 0.04
185 0.05
186 0.07
187 0.09
188 0.11
189 0.13
190 0.13
191 0.13
192 0.14
193 0.15
194 0.16
195 0.14
196 0.14
197 0.15
198 0.15
199 0.16
200 0.16
201 0.16
202 0.16
203 0.16
204 0.15
205 0.14
206 0.13
207 0.13
208 0.13
209 0.12
210 0.1
211 0.11
212 0.11
213 0.1
214 0.11
215 0.13
216 0.12
217 0.1
218 0.09
219 0.08
220 0.08
221 0.08
222 0.08
223 0.06
224 0.07
225 0.07
226 0.08
227 0.07
228 0.08
229 0.07
230 0.06
231 0.06
232 0.05
233 0.05
234 0.06
235 0.06
236 0.06
237 0.06
238 0.06
239 0.06
240 0.07
241 0.08
242 0.08
243 0.08
244 0.08
245 0.09
246 0.09
247 0.09
248 0.11
249 0.12
250 0.12
251 0.12
252 0.12
253 0.12
254 0.13
255 0.13
256 0.11
257 0.09
258 0.08
259 0.08
260 0.08
261 0.07
262 0.06
263 0.07
264 0.09
265 0.09
266 0.09
267 0.09
268 0.1
269 0.1
270 0.1
271 0.08
272 0.07
273 0.07
274 0.08
275 0.09
276 0.09
277 0.11
278 0.12
279 0.14
280 0.17
281 0.23
282 0.28
283 0.31
284 0.4
285 0.4
286 0.42
287 0.44
288 0.48
289 0.52
290 0.52
291 0.51
292 0.43
293 0.45
294 0.52
295 0.58
296 0.57
297 0.55
298 0.57
299 0.64
300 0.73
301 0.8
302 0.81
303 0.82
304 0.85
305 0.87
306 0.89
307 0.87
308 0.82
309 0.75
310 0.68
311 0.61
312 0.52
313 0.44
314 0.39
315 0.32
316 0.28
317 0.3
318 0.27
319 0.26
320 0.29
321 0.29
322 0.29
323 0.29
324 0.29
325 0.26
326 0.28
327 0.26
328 0.21
329 0.2
330 0.14
331 0.12
332 0.12
333 0.09
334 0.07
335 0.09
336 0.09
337 0.09
338 0.09
339 0.09
340 0.08
341 0.09
342 0.09