Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WIP0

Protein Details
Accession B2WIP0    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-88NKGEKRGKVHWDTRRKCRKSBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 11.5, cyto 7.5, mito 7
Family & Domain DBs
Amino Acid Sequences MTSPDKTSIFTTSLHTETPPNIEPRQETGGNGYGLVYEGYIHGVLKGTELAKEYEKLETKQERHDSIINKGEKRGKVHWDTRRKCRKSEDIEMG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.21
4 0.21
5 0.25
6 0.25
7 0.25
8 0.24
9 0.26
10 0.26
11 0.29
12 0.33
13 0.28
14 0.25
15 0.24
16 0.27
17 0.25
18 0.23
19 0.18
20 0.12
21 0.12
22 0.12
23 0.08
24 0.04
25 0.04
26 0.05
27 0.05
28 0.05
29 0.04
30 0.05
31 0.05
32 0.05
33 0.06
34 0.06
35 0.06
36 0.07
37 0.09
38 0.09
39 0.11
40 0.11
41 0.15
42 0.17
43 0.18
44 0.24
45 0.3
46 0.31
47 0.38
48 0.42
49 0.4
50 0.41
51 0.45
52 0.41
53 0.4
54 0.46
55 0.43
56 0.39
57 0.43
58 0.46
59 0.45
60 0.48
61 0.47
62 0.48
63 0.51
64 0.6
65 0.64
66 0.68
67 0.73
68 0.78
69 0.83
70 0.79
71 0.77
72 0.77
73 0.78
74 0.76