Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SHU6

Protein Details
Accession A0A0L0SHU6   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-159RRTASGAKPSPRRTKARRRRPRRLRLRLRKLSAGSSBasic
NLS Segment(s)
PositionSequence
119-154PRTRSRRTASGAKPSPRRTKARRRRPRRLRLRLRKL
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MRTPRAAALDPANPHILQRLEYVREVIRNGGVAPTNGTNAPPPPVPTGVLAANAAAMPPPPPAQLQQEVPMRPRSPSAAVSAAGVVPLPLPPPTVPAPAAAAASLAPPTTEAAVRSPTPRTRSRRTASGAKPSPRRTKARRRRPRRLRLRLRKLSAGSSPGAGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.25
4 0.2
5 0.23
6 0.25
7 0.25
8 0.26
9 0.29
10 0.26
11 0.28
12 0.27
13 0.24
14 0.2
15 0.17
16 0.17
17 0.16
18 0.15
19 0.13
20 0.14
21 0.14
22 0.14
23 0.14
24 0.14
25 0.13
26 0.13
27 0.16
28 0.15
29 0.16
30 0.17
31 0.18
32 0.19
33 0.18
34 0.19
35 0.16
36 0.16
37 0.14
38 0.11
39 0.09
40 0.08
41 0.07
42 0.05
43 0.04
44 0.04
45 0.05
46 0.06
47 0.07
48 0.08
49 0.1
50 0.15
51 0.17
52 0.18
53 0.23
54 0.27
55 0.27
56 0.29
57 0.32
58 0.28
59 0.26
60 0.26
61 0.22
62 0.2
63 0.2
64 0.2
65 0.17
66 0.16
67 0.16
68 0.15
69 0.12
70 0.09
71 0.08
72 0.05
73 0.03
74 0.03
75 0.04
76 0.04
77 0.05
78 0.05
79 0.09
80 0.1
81 0.12
82 0.12
83 0.12
84 0.13
85 0.13
86 0.13
87 0.09
88 0.08
89 0.06
90 0.06
91 0.06
92 0.05
93 0.04
94 0.04
95 0.05
96 0.06
97 0.06
98 0.07
99 0.08
100 0.12
101 0.13
102 0.15
103 0.2
104 0.24
105 0.29
106 0.37
107 0.43
108 0.49
109 0.58
110 0.61
111 0.63
112 0.64
113 0.69
114 0.66
115 0.7
116 0.69
117 0.68
118 0.72
119 0.73
120 0.77
121 0.74
122 0.78
123 0.77
124 0.8
125 0.83
126 0.86
127 0.89
128 0.89
129 0.93
130 0.94
131 0.95
132 0.95
133 0.96
134 0.96
135 0.96
136 0.96
137 0.96
138 0.91
139 0.88
140 0.8
141 0.75
142 0.68
143 0.6
144 0.5