Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SE68

Protein Details
Accession A0A0L0SE68    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAGNPRPTRPTRSRRSPNKRFSKISSRIHydrophilic
34-98SSRRSCAVPRRIRWRRSRRPRRARAATRRGRRAGRGRRTSCTTRPRNSRRVPRRARRARIWAVPAHydrophilic
NLS Segment(s)
PositionSequence
6-107RPTRPTRSRRSPNKRFSKISSRISARRGSSRRSCAVPRRIRWRRSRRPRRARAATRRGRRAGRGRRTSCTTRPRNSRRVPRRARRARIWAVPAGRRRRAGRG
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MAGNPRPTRPTRSRRSPNKRFSKISSRISARRGSSRRSCAVPRRIRWRRSRRPRRARAATRRGRRAGRGRRTSCTTRPRNSRRVPRRARRARIWAVPAGRRRRAGRGVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.9
3 0.92
4 0.92
5 0.93
6 0.91
7 0.86
8 0.83
9 0.82
10 0.8
11 0.77
12 0.75
13 0.7
14 0.67
15 0.65
16 0.63
17 0.56
18 0.57
19 0.53
20 0.52
21 0.53
22 0.54
23 0.54
24 0.52
25 0.56
26 0.55
27 0.62
28 0.63
29 0.62
30 0.66
31 0.72
32 0.76
33 0.79
34 0.81
35 0.82
36 0.85
37 0.89
38 0.89
39 0.92
40 0.93
41 0.93
42 0.92
43 0.92
44 0.91
45 0.9
46 0.88
47 0.86
48 0.84
49 0.79
50 0.72
51 0.69
52 0.69
53 0.68
54 0.69
55 0.71
56 0.67
57 0.67
58 0.71
59 0.7
60 0.68
61 0.68
62 0.66
63 0.65
64 0.72
65 0.75
66 0.78
67 0.82
68 0.84
69 0.84
70 0.86
71 0.88
72 0.88
73 0.91
74 0.92
75 0.91
76 0.89
77 0.88
78 0.85
79 0.82
80 0.77
81 0.72
82 0.68
83 0.67
84 0.67
85 0.66
86 0.64
87 0.63
88 0.62
89 0.64