Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0STH2

Protein Details
Accession A0A0L0STH2    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
12-44GKVKSQTPKVDKQEKKKKKTGRAKKRLLYTRRFBasic
NLS Segment(s)
PositionSequence
12-38GKVKSQTPKVDKQEKKKKKTGRAKKRL
Subcellular Location(s) mito 12, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVDKQEKKKKKTGRAKKRLLYTRRFVNAVATFGGKRKMNPAPTEKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.46
4 0.5
5 0.53
6 0.62
7 0.65
8 0.71
9 0.72
10 0.75
11 0.79
12 0.8
13 0.82
14 0.81
15 0.81
16 0.81
17 0.85
18 0.85
19 0.86
20 0.86
21 0.87
22 0.84
23 0.85
24 0.84
25 0.8
26 0.76
27 0.71
28 0.69
29 0.63
30 0.58
31 0.48
32 0.46
33 0.4
34 0.34
35 0.29
36 0.23
37 0.2
38 0.22
39 0.28
40 0.22
41 0.21
42 0.26
43 0.33
44 0.38
45 0.45