Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0T3L3

Protein Details
Accession A0A0L0T3L3   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
159-185RAPAGKLWKKPGRKRRPTRSSARFVTSHydrophilic
195-220TRTSFAKSRACRIRRRNRSWPTTCTAHydrophilic
NLS Segment(s)
PositionSequence
159-177RAPAGKLWKKPGRKRRPTR
Subcellular Location(s) nucl 18, cyto 5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR041247  Rad52_fam  
IPR007232  Rad52_Rad59_Rad22  
IPR042525  Rad52_Rad59_Rad22_sf  
Gene Ontology GO:0006310  P:DNA recombination  
GO:0006302  P:double-strand break repair  
Pfam View protein in Pfam  
PF04098  Rad52_Rad22  
Amino Acid Sequences MMMDDVADFSNTDPMLHTPVANGLASTRTARRSTTSLHAFSPVGDPDRPRPFGSNPFTLDEKIKIAYDLSRKLPPDCISSRSGGAAGRVTYLEGWKAIALANEIFGFNGWATQVLDQHIDFMDPGQTRAGRSGLTVRCASRCVTGRFARTSALACARIRAPAGKLWKKPGRKRRPTRSSARFVTSATPSATVSTTRTSFAKSRACRIRRRNRSWPTTCTARIQSRPDRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.18
3 0.18
4 0.18
5 0.14
6 0.17
7 0.18
8 0.17
9 0.15
10 0.11
11 0.12
12 0.14
13 0.16
14 0.17
15 0.2
16 0.22
17 0.23
18 0.27
19 0.28
20 0.31
21 0.37
22 0.41
23 0.39
24 0.38
25 0.39
26 0.35
27 0.33
28 0.31
29 0.25
30 0.21
31 0.2
32 0.22
33 0.27
34 0.34
35 0.36
36 0.35
37 0.37
38 0.38
39 0.45
40 0.48
41 0.46
42 0.41
43 0.42
44 0.42
45 0.39
46 0.37
47 0.29
48 0.25
49 0.21
50 0.18
51 0.15
52 0.14
53 0.17
54 0.21
55 0.23
56 0.25
57 0.28
58 0.29
59 0.3
60 0.34
61 0.32
62 0.33
63 0.31
64 0.31
65 0.29
66 0.29
67 0.29
68 0.24
69 0.23
70 0.17
71 0.15
72 0.13
73 0.11
74 0.1
75 0.09
76 0.09
77 0.09
78 0.09
79 0.08
80 0.06
81 0.06
82 0.05
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.05
93 0.06
94 0.04
95 0.04
96 0.04
97 0.04
98 0.05
99 0.05
100 0.06
101 0.07
102 0.08
103 0.07
104 0.08
105 0.07
106 0.07
107 0.06
108 0.06
109 0.09
110 0.08
111 0.09
112 0.1
113 0.1
114 0.11
115 0.12
116 0.13
117 0.09
118 0.09
119 0.16
120 0.16
121 0.19
122 0.21
123 0.2
124 0.2
125 0.22
126 0.22
127 0.2
128 0.23
129 0.23
130 0.28
131 0.32
132 0.35
133 0.36
134 0.36
135 0.31
136 0.27
137 0.26
138 0.22
139 0.22
140 0.22
141 0.19
142 0.21
143 0.2
144 0.2
145 0.2
146 0.19
147 0.17
148 0.18
149 0.28
150 0.34
151 0.37
152 0.45
153 0.52
154 0.6
155 0.69
156 0.75
157 0.76
158 0.8
159 0.87
160 0.89
161 0.92
162 0.9
163 0.91
164 0.9
165 0.87
166 0.81
167 0.75
168 0.65
169 0.56
170 0.52
171 0.44
172 0.38
173 0.3
174 0.25
175 0.21
176 0.21
177 0.2
178 0.17
179 0.16
180 0.17
181 0.17
182 0.18
183 0.19
184 0.22
185 0.25
186 0.31
187 0.39
188 0.38
189 0.47
190 0.55
191 0.62
192 0.68
193 0.75
194 0.79
195 0.81
196 0.87
197 0.88
198 0.87
199 0.91
200 0.88
201 0.84
202 0.79
203 0.77
204 0.71
205 0.67
206 0.66
207 0.64
208 0.64
209 0.66