Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0TAS0

Protein Details
Accession A0A0L0TAS0   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-44PTTTPGFESRRRRRPRFERIHADDRVBasic
NLS Segment(s)
PositionSequence
29-33RRRRP
Subcellular Location(s) nucl 8cyto 8cyto_nucl 8, mito 7
Family & Domain DBs
Amino Acid Sequences MPAALTPLPALLPTTAMPPTTTPGFESRRRRRPRFERIHADDRVDPDALADRLALLWTKYVSDVLLHNYAVLPADVVQGLETVEPVLRRLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.13
5 0.12
6 0.16
7 0.16
8 0.16
9 0.15
10 0.21
11 0.26
12 0.33
13 0.43
14 0.5
15 0.59
16 0.68
17 0.73
18 0.78
19 0.82
20 0.85
21 0.85
22 0.84
23 0.84
24 0.82
25 0.83
26 0.74
27 0.66
28 0.57
29 0.48
30 0.41
31 0.3
32 0.22
33 0.14
34 0.15
35 0.12
36 0.1
37 0.08
38 0.06
39 0.06
40 0.06
41 0.06
42 0.04
43 0.05
44 0.05
45 0.06
46 0.06
47 0.06
48 0.06
49 0.07
50 0.08
51 0.11
52 0.13
53 0.12
54 0.12
55 0.12
56 0.12
57 0.12
58 0.1
59 0.07
60 0.05
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.06
68 0.06
69 0.05
70 0.07
71 0.08
72 0.09