Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0SMZ9

Protein Details
Accession A0A0L0SMZ9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-117IAASCGNCRHWRRSRKRGSGRRSGSVIHydrophilic
NLS Segment(s)
PositionSequence
102-112RRSRKRGSGRR
Subcellular Location(s) mito 10, nucl 8, cyto 7
Family & Domain DBs
Amino Acid Sequences MERVERHGRVCRQRLHGVGHGRVQRHVSAGRERRGGCARRHFFGEKIRLNTAVYCSRCRLWSCTGDPTGGVVGAAGEVAEPGVRAEHKEEIAASCGNCRHWRRSRKRGSGRRSGSVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.66
3 0.64
4 0.61
5 0.57
6 0.56
7 0.53
8 0.47
9 0.45
10 0.41
11 0.35
12 0.31
13 0.3
14 0.28
15 0.34
16 0.4
17 0.42
18 0.46
19 0.45
20 0.47
21 0.52
22 0.54
23 0.5
24 0.54
25 0.52
26 0.48
27 0.53
28 0.49
29 0.44
30 0.46
31 0.48
32 0.43
33 0.43
34 0.42
35 0.38
36 0.36
37 0.33
38 0.29
39 0.27
40 0.23
41 0.22
42 0.22
43 0.22
44 0.25
45 0.25
46 0.25
47 0.23
48 0.26
49 0.27
50 0.3
51 0.3
52 0.27
53 0.25
54 0.22
55 0.18
56 0.13
57 0.1
58 0.05
59 0.04
60 0.03
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.03
69 0.04
70 0.05
71 0.06
72 0.09
73 0.12
74 0.12
75 0.13
76 0.14
77 0.14
78 0.17
79 0.17
80 0.14
81 0.15
82 0.17
83 0.2
84 0.28
85 0.32
86 0.39
87 0.47
88 0.58
89 0.66
90 0.75
91 0.82
92 0.85
93 0.92
94 0.92
95 0.91
96 0.91
97 0.88