Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0T8E7

Protein Details
Accession A0A0L0T8E7    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-49ASLNKIPIVKKRTKRFARHQSDRYVKVGPSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
12-57KKRTKRFARHQSDRYVKVGPSWRKPKGIDNRVRRRFKGQIPMPKIG
Subcellular Location(s) mito 18, nucl 5.5, cyto_nucl 5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVASLNKIPIVKKRTKRFARHQSDRYVKVGPSWRKPKGIDNRVRRRFKGQIPMPKIGYGSNKKTRHMLPSGFKKFLVRNPKDLEILLMHNKSYAAEVAHNVSAKKRASIVERARQLNVNVTNAHARLRTEEEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.76
3 0.83
4 0.85
5 0.89
6 0.9
7 0.91
8 0.87
9 0.86
10 0.85
11 0.79
12 0.71
13 0.63
14 0.52
15 0.48
16 0.51
17 0.48
18 0.49
19 0.55
20 0.56
21 0.58
22 0.6
23 0.63
24 0.64
25 0.67
26 0.67
27 0.69
28 0.76
29 0.8
30 0.84
31 0.77
32 0.73
33 0.7
34 0.67
35 0.67
36 0.63
37 0.63
38 0.63
39 0.65
40 0.59
41 0.52
42 0.45
43 0.37
44 0.37
45 0.33
46 0.34
47 0.4
48 0.41
49 0.41
50 0.45
51 0.45
52 0.42
53 0.41
54 0.38
55 0.36
56 0.44
57 0.48
58 0.45
59 0.43
60 0.41
61 0.39
62 0.4
63 0.44
64 0.36
65 0.38
66 0.41
67 0.43
68 0.42
69 0.39
70 0.34
71 0.24
72 0.25
73 0.23
74 0.2
75 0.17
76 0.16
77 0.16
78 0.15
79 0.14
80 0.12
81 0.08
82 0.09
83 0.1
84 0.12
85 0.14
86 0.15
87 0.15
88 0.16
89 0.21
90 0.2
91 0.2
92 0.2
93 0.22
94 0.26
95 0.36
96 0.43
97 0.46
98 0.53
99 0.54
100 0.54
101 0.53
102 0.5
103 0.48
104 0.43
105 0.37
106 0.3
107 0.3
108 0.33
109 0.3
110 0.32
111 0.25
112 0.23
113 0.24