Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WHV7

Protein Details
Accession B2WHV7    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-54TEFRCLFTQDIKRKQKRWQDGYLKFHTFHydrophilic
NLS Segment(s)
PositionSequence
176-186ARKEKEKEKEK
288-302RQPPAKTPRIPKGKV
Subcellular Location(s) nucl 14, mito 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR018838  DUF2439  
Pfam View protein in Pfam  
PF10382  DUF2439  
Amino Acid Sequences MTAPLRNTQHASAIAAIAASQNTAPVTEFRCLFTQDIKRKQKRWQDGYLKFHTFNNRVMVYDQARNFLGDTYYKDRNELQEGDELNLNNGALVEVAEAMGITHTDLTPLLEKKNKEAPPRPSAPSQSKPFQRPSSVVPTNAPRNGSQLRHKSLNTLLGTPKGPIGKAQPMKSPYDARKEKEKEKEKENQVIEERAPKRQKTAQAPPAWRASSPVQEESPAARSRVQVPARKPNKFIPPTATVITIESESDPHPTCLSDVSMPSTPPKVAKARAERRQLATPAPEPLSRQPPAKTPRIPKGKVPVPSVRALETPKQRAPPSSPPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.16
3 0.14
4 0.11
5 0.09
6 0.08
7 0.06
8 0.07
9 0.07
10 0.08
11 0.09
12 0.11
13 0.14
14 0.18
15 0.19
16 0.2
17 0.23
18 0.25
19 0.25
20 0.31
21 0.38
22 0.44
23 0.54
24 0.62
25 0.69
26 0.73
27 0.8
28 0.82
29 0.83
30 0.81
31 0.81
32 0.81
33 0.81
34 0.84
35 0.82
36 0.76
37 0.67
38 0.64
39 0.62
40 0.54
41 0.49
42 0.47
43 0.39
44 0.36
45 0.36
46 0.37
47 0.32
48 0.36
49 0.32
50 0.28
51 0.28
52 0.27
53 0.26
54 0.21
55 0.19
56 0.14
57 0.19
58 0.22
59 0.28
60 0.27
61 0.29
62 0.31
63 0.32
64 0.36
65 0.32
66 0.28
67 0.27
68 0.28
69 0.27
70 0.27
71 0.23
72 0.19
73 0.18
74 0.15
75 0.1
76 0.09
77 0.07
78 0.05
79 0.05
80 0.04
81 0.03
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.03
89 0.04
90 0.04
91 0.04
92 0.04
93 0.06
94 0.1
95 0.12
96 0.15
97 0.2
98 0.2
99 0.25
100 0.34
101 0.38
102 0.42
103 0.49
104 0.53
105 0.56
106 0.61
107 0.6
108 0.55
109 0.57
110 0.56
111 0.55
112 0.53
113 0.53
114 0.54
115 0.55
116 0.58
117 0.55
118 0.5
119 0.44
120 0.43
121 0.46
122 0.41
123 0.38
124 0.33
125 0.35
126 0.37
127 0.36
128 0.33
129 0.24
130 0.27
131 0.3
132 0.31
133 0.34
134 0.36
135 0.38
136 0.41
137 0.4
138 0.38
139 0.36
140 0.39
141 0.32
142 0.27
143 0.24
144 0.22
145 0.22
146 0.2
147 0.2
148 0.13
149 0.12
150 0.11
151 0.14
152 0.2
153 0.24
154 0.26
155 0.28
156 0.3
157 0.33
158 0.34
159 0.37
160 0.33
161 0.38
162 0.41
163 0.39
164 0.47
165 0.51
166 0.55
167 0.59
168 0.65
169 0.6
170 0.62
171 0.69
172 0.64
173 0.67
174 0.6
175 0.55
176 0.48
177 0.45
178 0.4
179 0.4
180 0.35
181 0.35
182 0.39
183 0.35
184 0.37
185 0.41
186 0.48
187 0.47
188 0.56
189 0.56
190 0.58
191 0.61
192 0.59
193 0.6
194 0.52
195 0.44
196 0.37
197 0.32
198 0.3
199 0.31
200 0.3
201 0.24
202 0.25
203 0.26
204 0.24
205 0.26
206 0.21
207 0.19
208 0.18
209 0.19
210 0.21
211 0.3
212 0.34
213 0.35
214 0.4
215 0.5
216 0.56
217 0.58
218 0.59
219 0.57
220 0.62
221 0.59
222 0.56
223 0.51
224 0.47
225 0.48
226 0.45
227 0.39
228 0.29
229 0.26
230 0.24
231 0.18
232 0.14
233 0.1
234 0.11
235 0.1
236 0.13
237 0.14
238 0.14
239 0.14
240 0.14
241 0.14
242 0.14
243 0.16
244 0.14
245 0.14
246 0.17
247 0.18
248 0.19
249 0.21
250 0.22
251 0.21
252 0.2
253 0.25
254 0.27
255 0.31
256 0.4
257 0.48
258 0.56
259 0.64
260 0.72
261 0.72
262 0.71
263 0.72
264 0.66
265 0.6
266 0.56
267 0.49
268 0.45
269 0.43
270 0.39
271 0.35
272 0.39
273 0.42
274 0.39
275 0.41
276 0.38
277 0.44
278 0.5
279 0.55
280 0.57
281 0.58
282 0.66
283 0.72
284 0.72
285 0.71
286 0.74
287 0.72
288 0.71
289 0.69
290 0.68
291 0.62
292 0.64
293 0.59
294 0.51
295 0.48
296 0.46
297 0.48
298 0.48
299 0.52
300 0.52
301 0.57
302 0.57
303 0.59
304 0.61