Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0S8S8

Protein Details
Accession A0A0L0S8S8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
224-243DGMPPRQKRRGRCRDFDGAPBasic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR002483  PWI_dom  
IPR045137  RBM26/27  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF01480  PWI  
Amino Acid Sequences MSIIDETTTEELKAFIQRQLEPICEADSGVLSDYIIALLRHDMEFDDLKIFCIEQLSDFLASSTQQFVDALFDALRTKSYLPRPPAPAAFHTPAPASVAPPAAAPAPAPPRRAPTPPAAAAAPAPPAQQAMSGDDSLRSPGRARHPVHPHDGGFPPQLGAPAPAPAHGGFPASDGGFPRSDPPAPAGFPHGASSPPHMPPGAVMPPPVRDRDRPFGPIPSGLGDGMPPRQKRRGRCRDFDGAPRAFARRGMGLFFGQMELMDCGVRRIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.24
4 0.25
5 0.31
6 0.33
7 0.33
8 0.29
9 0.28
10 0.27
11 0.22
12 0.21
13 0.15
14 0.13
15 0.12
16 0.11
17 0.09
18 0.07
19 0.07
20 0.07
21 0.07
22 0.07
23 0.06
24 0.06
25 0.07
26 0.09
27 0.09
28 0.1
29 0.1
30 0.12
31 0.13
32 0.13
33 0.16
34 0.14
35 0.15
36 0.15
37 0.15
38 0.12
39 0.12
40 0.11
41 0.09
42 0.11
43 0.12
44 0.12
45 0.12
46 0.11
47 0.1
48 0.1
49 0.1
50 0.1
51 0.08
52 0.08
53 0.08
54 0.08
55 0.1
56 0.1
57 0.1
58 0.08
59 0.09
60 0.09
61 0.1
62 0.1
63 0.09
64 0.1
65 0.16
66 0.23
67 0.3
68 0.35
69 0.41
70 0.46
71 0.48
72 0.51
73 0.47
74 0.44
75 0.43
76 0.4
77 0.34
78 0.3
79 0.26
80 0.22
81 0.22
82 0.19
83 0.13
84 0.11
85 0.12
86 0.1
87 0.1
88 0.1
89 0.08
90 0.07
91 0.07
92 0.09
93 0.17
94 0.2
95 0.23
96 0.23
97 0.28
98 0.31
99 0.34
100 0.33
101 0.31
102 0.33
103 0.32
104 0.32
105 0.27
106 0.24
107 0.22
108 0.19
109 0.15
110 0.1
111 0.09
112 0.07
113 0.08
114 0.07
115 0.08
116 0.08
117 0.08
118 0.09
119 0.09
120 0.09
121 0.1
122 0.1
123 0.1
124 0.1
125 0.08
126 0.08
127 0.12
128 0.19
129 0.27
130 0.3
131 0.37
132 0.45
133 0.48
134 0.53
135 0.51
136 0.45
137 0.4
138 0.39
139 0.33
140 0.25
141 0.22
142 0.17
143 0.14
144 0.13
145 0.1
146 0.1
147 0.08
148 0.09
149 0.09
150 0.09
151 0.11
152 0.1
153 0.11
154 0.1
155 0.1
156 0.08
157 0.09
158 0.09
159 0.08
160 0.09
161 0.09
162 0.11
163 0.1
164 0.11
165 0.12
166 0.13
167 0.14
168 0.14
169 0.16
170 0.17
171 0.17
172 0.17
173 0.19
174 0.17
175 0.17
176 0.18
177 0.16
178 0.14
179 0.15
180 0.19
181 0.2
182 0.2
183 0.21
184 0.19
185 0.19
186 0.18
187 0.22
188 0.21
189 0.17
190 0.18
191 0.18
192 0.23
193 0.25
194 0.3
195 0.28
196 0.3
197 0.37
198 0.44
199 0.46
200 0.47
201 0.47
202 0.48
203 0.46
204 0.42
205 0.36
206 0.3
207 0.27
208 0.21
209 0.19
210 0.15
211 0.14
212 0.19
213 0.25
214 0.26
215 0.31
216 0.4
217 0.47
218 0.56
219 0.66
220 0.71
221 0.73
222 0.77
223 0.8
224 0.8
225 0.79
226 0.78
227 0.75
228 0.66
229 0.59
230 0.53
231 0.49
232 0.4
233 0.36
234 0.3
235 0.26
236 0.25
237 0.24
238 0.24
239 0.22
240 0.22
241 0.21
242 0.18
243 0.13
244 0.12
245 0.12
246 0.1
247 0.1
248 0.1
249 0.09