Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SM35

Protein Details
Accession A0A0L0SM35   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
285-305VSVPRRTPPPPPPSRPRAKSAHydrophilic
NLS Segment(s)
PositionSequence
257-260RSRS
276-331RAARRAAAKVSVPRRTPPPPPPSRPRAKSATAAAGRGVVGRFDRSPRVAHAARTRR
Subcellular Location(s) extr 10, mito 9, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MPSLPSAPAPSSTVRGWFSAAMTVTGAATSAATLPARSWASRAWLPPWTAAGAPTSPPAVNSAASSDVDDAMSDASDLDDADEWQVVVCHMTDFAAPQPVSTVPLRRLDAALQTVAHACLRDEYEDDEADDADDESVDLSDDYEDDEDLQLAPHVRAPAAGATTLLPPTWLDAPPTAAPSRTTTPAAAVVLPPFRSTTPGARVVLAPSRTTTPGALPLFRSTTPGTQAPAPARPASTPPSTTTAIDPATGEPRARSRSRSRRGSLIDAAAQVDAARAARRAAAKVSVPRRTPPPPPPSRPRAKSATAAAGRGVVGRFDRSPRVAHAARTRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.25
4 0.24
5 0.22
6 0.22
7 0.21
8 0.17
9 0.16
10 0.15
11 0.13
12 0.11
13 0.11
14 0.06
15 0.06
16 0.05
17 0.05
18 0.07
19 0.07
20 0.08
21 0.08
22 0.14
23 0.16
24 0.16
25 0.17
26 0.17
27 0.24
28 0.28
29 0.3
30 0.28
31 0.31
32 0.33
33 0.32
34 0.32
35 0.28
36 0.24
37 0.21
38 0.2
39 0.16
40 0.16
41 0.15
42 0.15
43 0.14
44 0.14
45 0.15
46 0.14
47 0.14
48 0.13
49 0.14
50 0.14
51 0.14
52 0.15
53 0.13
54 0.12
55 0.11
56 0.1
57 0.09
58 0.07
59 0.06
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.05
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.08
82 0.13
83 0.13
84 0.13
85 0.14
86 0.14
87 0.17
88 0.18
89 0.2
90 0.17
91 0.23
92 0.24
93 0.23
94 0.24
95 0.22
96 0.24
97 0.22
98 0.19
99 0.14
100 0.13
101 0.13
102 0.13
103 0.12
104 0.09
105 0.07
106 0.08
107 0.09
108 0.09
109 0.09
110 0.11
111 0.12
112 0.12
113 0.12
114 0.11
115 0.1
116 0.09
117 0.08
118 0.07
119 0.04
120 0.04
121 0.04
122 0.03
123 0.03
124 0.04
125 0.03
126 0.03
127 0.03
128 0.03
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.08
146 0.07
147 0.07
148 0.06
149 0.06
150 0.07
151 0.07
152 0.06
153 0.06
154 0.05
155 0.06
156 0.08
157 0.07
158 0.08
159 0.08
160 0.11
161 0.11
162 0.14
163 0.13
164 0.11
165 0.12
166 0.15
167 0.17
168 0.17
169 0.17
170 0.15
171 0.16
172 0.16
173 0.16
174 0.13
175 0.11
176 0.1
177 0.11
178 0.11
179 0.11
180 0.1
181 0.1
182 0.12
183 0.14
184 0.17
185 0.19
186 0.24
187 0.24
188 0.24
189 0.24
190 0.24
191 0.27
192 0.23
193 0.19
194 0.16
195 0.17
196 0.18
197 0.18
198 0.16
199 0.12
200 0.19
201 0.19
202 0.19
203 0.19
204 0.2
205 0.21
206 0.21
207 0.23
208 0.18
209 0.18
210 0.21
211 0.21
212 0.2
213 0.19
214 0.23
215 0.22
216 0.24
217 0.25
218 0.22
219 0.22
220 0.21
221 0.23
222 0.24
223 0.25
224 0.23
225 0.23
226 0.27
227 0.28
228 0.28
229 0.26
230 0.25
231 0.22
232 0.2
233 0.18
234 0.15
235 0.17
236 0.17
237 0.16
238 0.15
239 0.2
240 0.26
241 0.28
242 0.33
243 0.41
244 0.5
245 0.6
246 0.68
247 0.66
248 0.68
249 0.71
250 0.71
251 0.65
252 0.57
253 0.5
254 0.41
255 0.38
256 0.29
257 0.23
258 0.16
259 0.12
260 0.09
261 0.07
262 0.07
263 0.07
264 0.08
265 0.12
266 0.14
267 0.16
268 0.18
269 0.21
270 0.26
271 0.34
272 0.42
273 0.46
274 0.47
275 0.49
276 0.54
277 0.56
278 0.59
279 0.6
280 0.62
281 0.65
282 0.71
283 0.76
284 0.79
285 0.84
286 0.81
287 0.78
288 0.75
289 0.69
290 0.67
291 0.63
292 0.63
293 0.55
294 0.51
295 0.44
296 0.38
297 0.33
298 0.29
299 0.24
300 0.16
301 0.15
302 0.18
303 0.2
304 0.24
305 0.3
306 0.3
307 0.32
308 0.35
309 0.42
310 0.41
311 0.46