Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0S340

Protein Details
Accession A0A0L0S340    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-95AGRPPFRSTRPRRCRPARARVVVHydrophilic
114-149RSLAAQRPPRPARCRARRRRRARIRPRKADPCATPDBasic
NLS Segment(s)
PositionSequence
73-141AGRPPFRSTRPRRCRPARARVVVARPPAQRNRPALAPSSLARSLAAQRPPRPARCRARRRRRARIRPRK
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
Amino Acid Sequences MVRAPRGWKREQVRGCEAAALGMRSEDSLRGRVRLRSRCVARTLAARVGFESASPVSRLPRLALQREVGPPAAGRPPFRSTRPRRCRPARARVVVARPPAQRNRPALAPSSLARSLAAQRPPRPARCRARRRRRARIRPRKADPCATPDLLVRDRTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.57
3 0.5
4 0.43
5 0.35
6 0.3
7 0.22
8 0.15
9 0.12
10 0.12
11 0.1
12 0.11
13 0.12
14 0.12
15 0.17
16 0.19
17 0.23
18 0.26
19 0.32
20 0.41
21 0.46
22 0.5
23 0.54
24 0.58
25 0.59
26 0.6
27 0.56
28 0.49
29 0.46
30 0.43
31 0.39
32 0.34
33 0.3
34 0.26
35 0.25
36 0.22
37 0.17
38 0.15
39 0.1
40 0.1
41 0.1
42 0.1
43 0.1
44 0.12
45 0.13
46 0.12
47 0.17
48 0.21
49 0.23
50 0.25
51 0.25
52 0.26
53 0.27
54 0.27
55 0.21
56 0.17
57 0.14
58 0.13
59 0.16
60 0.14
61 0.14
62 0.16
63 0.2
64 0.23
65 0.27
66 0.36
67 0.41
68 0.51
69 0.6
70 0.65
71 0.71
72 0.77
73 0.84
74 0.83
75 0.84
76 0.83
77 0.77
78 0.74
79 0.69
80 0.67
81 0.6
82 0.55
83 0.5
84 0.43
85 0.45
86 0.46
87 0.46
88 0.46
89 0.46
90 0.45
91 0.43
92 0.41
93 0.38
94 0.33
95 0.31
96 0.25
97 0.26
98 0.24
99 0.2
100 0.19
101 0.18
102 0.2
103 0.23
104 0.3
105 0.31
106 0.35
107 0.45
108 0.52
109 0.59
110 0.6
111 0.64
112 0.68
113 0.72
114 0.8
115 0.81
116 0.86
117 0.88
118 0.93
119 0.94
120 0.95
121 0.95
122 0.95
123 0.96
124 0.95
125 0.95
126 0.95
127 0.94
128 0.9
129 0.88
130 0.81
131 0.76
132 0.72
133 0.63
134 0.54
135 0.47
136 0.47
137 0.41