Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0RZ87

Protein Details
Accession A0A0L0RZ87    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-37THPYKRSSVRMLQRKAKRRANEKSSTTHydrophilic
NLS Segment(s)
PositionSequence
23-30QRKAKRRA
50-68SKKKLKKINHNGKKKLTIR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MSGGVHAHNKTHPYKRSSVRMLQRKAKRRANEKSSTTVAPAIIRSNTELSKKKLKKINHNGKKKLTIRNVAKVKEAALEAKAASGDVDMSEAQSRAVRRAAEHAAKAQSKKAAKTAATDAMDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.68
4 0.69
5 0.7
6 0.72
7 0.74
8 0.77
9 0.78
10 0.79
11 0.8
12 0.83
13 0.82
14 0.8
15 0.8
16 0.82
17 0.81
18 0.81
19 0.75
20 0.71
21 0.66
22 0.58
23 0.49
24 0.4
25 0.32
26 0.23
27 0.2
28 0.17
29 0.13
30 0.13
31 0.13
32 0.14
33 0.15
34 0.2
35 0.24
36 0.26
37 0.37
38 0.39
39 0.45
40 0.5
41 0.54
42 0.6
43 0.66
44 0.73
45 0.73
46 0.79
47 0.79
48 0.77
49 0.79
50 0.73
51 0.71
52 0.65
53 0.65
54 0.6
55 0.62
56 0.63
57 0.55
58 0.52
59 0.43
60 0.38
61 0.3
62 0.26
63 0.18
64 0.12
65 0.12
66 0.1
67 0.1
68 0.09
69 0.07
70 0.06
71 0.05
72 0.05
73 0.04
74 0.05
75 0.05
76 0.06
77 0.07
78 0.07
79 0.08
80 0.11
81 0.11
82 0.13
83 0.16
84 0.16
85 0.16
86 0.22
87 0.29
88 0.31
89 0.33
90 0.35
91 0.39
92 0.43
93 0.43
94 0.42
95 0.42
96 0.42
97 0.42
98 0.44
99 0.43
100 0.4
101 0.43
102 0.45
103 0.45
104 0.42