Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0L0S241

Protein Details
Accession A0A0L0S241    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-39KAKSETATKRVRKEKAEKKPRAKKDPNKPKRPMTAFFBasic
NLS Segment(s)
PositionSequence
9-33ATKRVRKEKAEKKPRAKKDPNKPKR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKAKSETATKRVRKEKAEKKPRAKKDPNKPKRPMTAFFIFSGEFRDQVKAQNPGATVGTVAKILGERWRNMGEAEKAPYALKVEQDKKRYETELAIYEANKSADAAQAEDAEEEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.8
4 0.81
5 0.85
6 0.86
7 0.88
8 0.91
9 0.92
10 0.92
11 0.93
12 0.91
13 0.92
14 0.93
15 0.93
16 0.93
17 0.9
18 0.87
19 0.86
20 0.82
21 0.74
22 0.7
23 0.65
24 0.57
25 0.5
26 0.43
27 0.33
28 0.27
29 0.27
30 0.2
31 0.15
32 0.13
33 0.15
34 0.14
35 0.17
36 0.21
37 0.21
38 0.21
39 0.22
40 0.22
41 0.2
42 0.2
43 0.16
44 0.13
45 0.09
46 0.09
47 0.06
48 0.06
49 0.05
50 0.04
51 0.05
52 0.1
53 0.13
54 0.13
55 0.16
56 0.17
57 0.17
58 0.18
59 0.22
60 0.2
61 0.19
62 0.22
63 0.19
64 0.19
65 0.19
66 0.19
67 0.17
68 0.15
69 0.17
70 0.22
71 0.3
72 0.37
73 0.42
74 0.46
75 0.46
76 0.49
77 0.48
78 0.42
79 0.37
80 0.34
81 0.32
82 0.31
83 0.29
84 0.25
85 0.24
86 0.24
87 0.21
88 0.17
89 0.14
90 0.12
91 0.14
92 0.15
93 0.15
94 0.14
95 0.14
96 0.15
97 0.14