Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0S036

Protein Details
Accession A0A0L0S036    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
169-214MEWVDAQRRRRRPNRPPRRQPKQPKRGKKNKPKPSQPKPTPPPHHDBasic
273-295VRLADRPCSRRRRLVTHIRCPFSHydrophilic
NLS Segment(s)
PositionSequence
176-209RRRRRPNRPPRRQPKQPKRGKKNKPKPSQPKPTP
Subcellular Location(s) mito 11, nucl 7, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR008947  PLipase_C/P1_nuclease_dom_sf  
IPR003154  S1/P1nuclease  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0046872  F:metal ion binding  
GO:0003676  F:nucleic acid binding  
GO:0006308  P:DNA catabolic process  
Pfam View protein in Pfam  
PF02265  S1-P1_nuclease  
CDD cd11010  S1-P1_nuclease  
Amino Acid Sequences MRQPAAPLLAALAAATALLLAAAASQVAAWGHTGHSLTGRIAMQLVQPSTRRALQQLLPEVNGDIARISSWADEVKRQARFSDTGPLHYSDAHDDPPHACSYMMARDCPDGNCITVAIQEFSWAVRNATLAKPTPAPPAPEMPDFASLDKRSANDDYVDISELVPLHMMEWVDAQRRRRRPNRPPRRQPKQPKRGKKNKPKPSQPKPTPPPHHDDKPDKSLPLGQRYTVVESLKFLVHLVQDIHQPLHLSGRDRGGNDMHVTYNHRASNLHSVRLADRPCSRRRRLVTHIRCPFSLRRCGIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.04
14 0.04
15 0.04
16 0.05
17 0.06
18 0.07
19 0.09
20 0.1
21 0.1
22 0.12
23 0.13
24 0.13
25 0.16
26 0.16
27 0.14
28 0.14
29 0.14
30 0.15
31 0.18
32 0.19
33 0.19
34 0.2
35 0.22
36 0.25
37 0.27
38 0.26
39 0.24
40 0.28
41 0.29
42 0.35
43 0.4
44 0.38
45 0.36
46 0.35
47 0.32
48 0.28
49 0.24
50 0.16
51 0.09
52 0.07
53 0.07
54 0.06
55 0.07
56 0.06
57 0.07
58 0.1
59 0.11
60 0.14
61 0.2
62 0.26
63 0.3
64 0.3
65 0.3
66 0.31
67 0.32
68 0.31
69 0.35
70 0.29
71 0.29
72 0.31
73 0.31
74 0.28
75 0.27
76 0.26
77 0.19
78 0.2
79 0.18
80 0.16
81 0.15
82 0.16
83 0.17
84 0.17
85 0.13
86 0.12
87 0.1
88 0.13
89 0.18
90 0.19
91 0.17
92 0.18
93 0.19
94 0.2
95 0.2
96 0.2
97 0.13
98 0.12
99 0.12
100 0.11
101 0.09
102 0.1
103 0.1
104 0.08
105 0.08
106 0.08
107 0.07
108 0.08
109 0.1
110 0.09
111 0.09
112 0.08
113 0.09
114 0.11
115 0.12
116 0.15
117 0.13
118 0.14
119 0.16
120 0.17
121 0.21
122 0.21
123 0.22
124 0.21
125 0.24
126 0.25
127 0.24
128 0.24
129 0.2
130 0.21
131 0.19
132 0.18
133 0.18
134 0.16
135 0.16
136 0.15
137 0.15
138 0.14
139 0.15
140 0.15
141 0.12
142 0.12
143 0.12
144 0.12
145 0.12
146 0.1
147 0.08
148 0.08
149 0.08
150 0.07
151 0.06
152 0.05
153 0.05
154 0.06
155 0.06
156 0.05
157 0.06
158 0.08
159 0.14
160 0.17
161 0.23
162 0.3
163 0.38
164 0.48
165 0.55
166 0.65
167 0.7
168 0.79
169 0.84
170 0.88
171 0.91
172 0.93
173 0.93
174 0.94
175 0.94
176 0.94
177 0.93
178 0.92
179 0.92
180 0.93
181 0.94
182 0.94
183 0.94
184 0.93
185 0.93
186 0.93
187 0.93
188 0.93
189 0.93
190 0.93
191 0.91
192 0.91
193 0.88
194 0.89
195 0.86
196 0.8
197 0.76
198 0.73
199 0.71
200 0.69
201 0.69
202 0.65
203 0.64
204 0.62
205 0.55
206 0.49
207 0.48
208 0.46
209 0.46
210 0.41
211 0.33
212 0.34
213 0.35
214 0.38
215 0.34
216 0.3
217 0.21
218 0.21
219 0.23
220 0.19
221 0.17
222 0.13
223 0.12
224 0.11
225 0.13
226 0.12
227 0.12
228 0.15
229 0.17
230 0.17
231 0.16
232 0.17
233 0.15
234 0.21
235 0.22
236 0.22
237 0.23
238 0.29
239 0.31
240 0.31
241 0.33
242 0.29
243 0.29
244 0.28
245 0.27
246 0.22
247 0.21
248 0.26
249 0.27
250 0.31
251 0.29
252 0.27
253 0.26
254 0.29
255 0.38
256 0.36
257 0.35
258 0.31
259 0.32
260 0.34
261 0.4
262 0.38
263 0.34
264 0.39
265 0.43
266 0.51
267 0.59
268 0.63
269 0.66
270 0.72
271 0.75
272 0.76
273 0.8
274 0.81
275 0.82
276 0.85
277 0.8
278 0.73
279 0.69
280 0.68
281 0.64
282 0.64