Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SI83

Protein Details
Accession A0A0L0SI83   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-30AVTGLRSRKRPRSPILAAPTTHydrophilic
NLS Segment(s)
PositionSequence
93-116GKTPAKYQPGARIAARRRVPLAPR
Subcellular Location(s) mito 21, nucl 4
Family & Domain DBs
Amino Acid Sequences MTSTTSTSIAVTGLRSRKRPRSPILAAPTTKDAKDAVDEHPRRKQRTAAPTRASTSRPPVSLELDFDEPDAHDPFNTAVPAPRAKRNEHPDAGKTPAKYQPGARIAARRRVPLAPRAAQPSTRSVSRKRNAVAVAEKQEEQPDWPPSPAKTSPPAVAKRANSVVSVASSRDGAQENVAPPCLETLPTPVLRRVARYLRRRATLSALARCSHTLFDQIGPCLWADPWDVHQPGAWERMVADERLALMLTEPGTHPVGADYAQWVCTPTSAHPGEWLRRAGRDAGTPPPAPLTLITSLDLVLDRHRARNWLEDAPTIKALVVNAAMEKYRRRFPKPFMELVAAQFAHLERLHIDAAQPFFKPLADLVETDGATWHHAIKDVRFTCHLTAPAETEFLATFLRSCPDLQSLSLTVQNAATAATLAPLATVAPQLTQLRRCHLIPPDDSVSQSGSLARFLVDFFTALPKLAGGTSNCTRAPGTRGSRYFTSFTLCPSNPNATPCAFTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.4
3 0.49
4 0.58
5 0.68
6 0.75
7 0.75
8 0.77
9 0.78
10 0.8
11 0.8
12 0.79
13 0.7
14 0.64
15 0.63
16 0.56
17 0.49
18 0.4
19 0.32
20 0.25
21 0.28
22 0.28
23 0.27
24 0.35
25 0.4
26 0.45
27 0.54
28 0.6
29 0.61
30 0.62
31 0.64
32 0.63
33 0.69
34 0.73
35 0.74
36 0.73
37 0.72
38 0.73
39 0.69
40 0.63
41 0.57
42 0.56
43 0.51
44 0.45
45 0.43
46 0.42
47 0.42
48 0.4
49 0.37
50 0.32
51 0.28
52 0.27
53 0.24
54 0.21
55 0.17
56 0.18
57 0.17
58 0.13
59 0.11
60 0.12
61 0.13
62 0.14
63 0.14
64 0.12
65 0.14
66 0.18
67 0.26
68 0.29
69 0.36
70 0.38
71 0.42
72 0.52
73 0.56
74 0.61
75 0.6
76 0.62
77 0.59
78 0.59
79 0.6
80 0.55
81 0.48
82 0.44
83 0.43
84 0.41
85 0.39
86 0.38
87 0.41
88 0.42
89 0.44
90 0.42
91 0.45
92 0.47
93 0.53
94 0.54
95 0.47
96 0.46
97 0.48
98 0.49
99 0.48
100 0.5
101 0.46
102 0.47
103 0.5
104 0.49
105 0.46
106 0.44
107 0.43
108 0.38
109 0.39
110 0.4
111 0.41
112 0.49
113 0.52
114 0.56
115 0.52
116 0.54
117 0.5
118 0.51
119 0.5
120 0.46
121 0.46
122 0.41
123 0.41
124 0.35
125 0.35
126 0.3
127 0.26
128 0.24
129 0.24
130 0.23
131 0.24
132 0.25
133 0.24
134 0.3
135 0.3
136 0.29
137 0.29
138 0.3
139 0.33
140 0.39
141 0.42
142 0.4
143 0.44
144 0.41
145 0.41
146 0.42
147 0.37
148 0.3
149 0.27
150 0.23
151 0.18
152 0.18
153 0.13
154 0.1
155 0.1
156 0.1
157 0.11
158 0.12
159 0.11
160 0.11
161 0.14
162 0.15
163 0.15
164 0.16
165 0.13
166 0.12
167 0.13
168 0.12
169 0.09
170 0.08
171 0.11
172 0.14
173 0.17
174 0.19
175 0.19
176 0.24
177 0.24
178 0.26
179 0.28
180 0.33
181 0.39
182 0.47
183 0.55
184 0.56
185 0.59
186 0.59
187 0.55
188 0.51
189 0.5
190 0.46
191 0.42
192 0.39
193 0.35
194 0.34
195 0.33
196 0.28
197 0.21
198 0.16
199 0.13
200 0.12
201 0.14
202 0.15
203 0.14
204 0.14
205 0.13
206 0.13
207 0.1
208 0.09
209 0.07
210 0.07
211 0.07
212 0.1
213 0.15
214 0.15
215 0.14
216 0.15
217 0.15
218 0.16
219 0.18
220 0.15
221 0.1
222 0.1
223 0.13
224 0.13
225 0.12
226 0.11
227 0.08
228 0.08
229 0.08
230 0.08
231 0.05
232 0.04
233 0.05
234 0.05
235 0.05
236 0.05
237 0.07
238 0.07
239 0.07
240 0.07
241 0.06
242 0.07
243 0.06
244 0.07
245 0.06
246 0.06
247 0.07
248 0.07
249 0.08
250 0.07
251 0.07
252 0.08
253 0.08
254 0.15
255 0.15
256 0.15
257 0.19
258 0.22
259 0.24
260 0.27
261 0.29
262 0.22
263 0.23
264 0.24
265 0.22
266 0.2
267 0.2
268 0.19
269 0.2
270 0.24
271 0.23
272 0.22
273 0.21
274 0.19
275 0.17
276 0.15
277 0.13
278 0.11
279 0.11
280 0.12
281 0.11
282 0.11
283 0.11
284 0.11
285 0.08
286 0.07
287 0.12
288 0.13
289 0.15
290 0.16
291 0.19
292 0.2
293 0.27
294 0.3
295 0.28
296 0.28
297 0.29
298 0.3
299 0.29
300 0.28
301 0.21
302 0.17
303 0.13
304 0.12
305 0.1
306 0.08
307 0.06
308 0.06
309 0.07
310 0.08
311 0.09
312 0.13
313 0.16
314 0.22
315 0.28
316 0.35
317 0.41
318 0.48
319 0.57
320 0.6
321 0.6
322 0.56
323 0.54
324 0.48
325 0.43
326 0.4
327 0.29
328 0.22
329 0.19
330 0.16
331 0.14
332 0.13
333 0.12
334 0.08
335 0.11
336 0.11
337 0.1
338 0.12
339 0.12
340 0.14
341 0.16
342 0.15
343 0.13
344 0.13
345 0.13
346 0.13
347 0.1
348 0.12
349 0.12
350 0.12
351 0.13
352 0.17
353 0.16
354 0.16
355 0.16
356 0.12
357 0.12
358 0.13
359 0.12
360 0.09
361 0.13
362 0.15
363 0.16
364 0.26
365 0.27
366 0.29
367 0.31
368 0.33
369 0.31
370 0.33
371 0.34
372 0.25
373 0.25
374 0.24
375 0.22
376 0.2
377 0.18
378 0.15
379 0.12
380 0.11
381 0.1
382 0.08
383 0.07
384 0.08
385 0.09
386 0.1
387 0.1
388 0.12
389 0.15
390 0.16
391 0.16
392 0.19
393 0.19
394 0.19
395 0.22
396 0.19
397 0.17
398 0.16
399 0.15
400 0.11
401 0.1
402 0.08
403 0.06
404 0.05
405 0.05
406 0.05
407 0.05
408 0.05
409 0.04
410 0.05
411 0.05
412 0.06
413 0.06
414 0.06
415 0.11
416 0.15
417 0.2
418 0.27
419 0.29
420 0.33
421 0.37
422 0.38
423 0.4
424 0.43
425 0.46
426 0.41
427 0.45
428 0.45
429 0.42
430 0.42
431 0.37
432 0.32
433 0.25
434 0.23
435 0.19
436 0.14
437 0.14
438 0.14
439 0.13
440 0.11
441 0.11
442 0.12
443 0.09
444 0.09
445 0.09
446 0.14
447 0.14
448 0.14
449 0.14
450 0.12
451 0.12
452 0.13
453 0.17
454 0.13
455 0.2
456 0.23
457 0.28
458 0.28
459 0.29
460 0.29
461 0.28
462 0.32
463 0.34
464 0.38
465 0.43
466 0.46
467 0.51
468 0.54
469 0.55
470 0.53
471 0.44
472 0.43
473 0.34
474 0.35
475 0.38
476 0.34
477 0.34
478 0.36
479 0.42
480 0.39
481 0.41
482 0.41
483 0.33