Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0L0SQ22

Protein Details
Accession A0A0L0SQ22    Localization Confidence High Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
169-199ATPRILRPSKRPARPSRPSRKRPNPGGWFGGHydrophilic
NLS Segment(s)
PositionSequence
87-96RDAPRRSRRP
171-193PRILRPSKRPARPSRPSRKRPNP
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
Amino Acid Sequences MAAPVITIDSDDEVTVSLPASWKTAAPSRPLEASARQRIVVQLDDDDDDDIIPSAPALAQAPTRRARRVAAVSDTVTEPTPQSPARRDAPRRSRRPPDPPPAPVPAVAPRLTPPTSAPVPAPTPAVDNDDWDDFDLTTSMPPPGHVSIKSSSPARATRSRSSSLPATPATPRILRPSKRPARPSRPSRKRPNPGGWFGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.07
5 0.08
6 0.09
7 0.11
8 0.11
9 0.11
10 0.15
11 0.22
12 0.24
13 0.28
14 0.31
15 0.32
16 0.33
17 0.34
18 0.34
19 0.35
20 0.41
21 0.44
22 0.42
23 0.39
24 0.38
25 0.38
26 0.38
27 0.32
28 0.24
29 0.17
30 0.16
31 0.17
32 0.16
33 0.14
34 0.12
35 0.09
36 0.08
37 0.07
38 0.06
39 0.05
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.06
46 0.09
47 0.12
48 0.17
49 0.24
50 0.27
51 0.29
52 0.3
53 0.31
54 0.34
55 0.37
56 0.36
57 0.32
58 0.32
59 0.3
60 0.3
61 0.28
62 0.23
63 0.18
64 0.14
65 0.11
66 0.09
67 0.11
68 0.12
69 0.14
70 0.16
71 0.21
72 0.27
73 0.35
74 0.4
75 0.48
76 0.57
77 0.65
78 0.7
79 0.73
80 0.75
81 0.75
82 0.78
83 0.77
84 0.75
85 0.71
86 0.67
87 0.63
88 0.57
89 0.5
90 0.41
91 0.34
92 0.28
93 0.25
94 0.21
95 0.18
96 0.16
97 0.19
98 0.19
99 0.18
100 0.15
101 0.17
102 0.17
103 0.18
104 0.17
105 0.16
106 0.17
107 0.17
108 0.17
109 0.12
110 0.13
111 0.13
112 0.17
113 0.14
114 0.14
115 0.15
116 0.15
117 0.15
118 0.14
119 0.14
120 0.09
121 0.1
122 0.08
123 0.07
124 0.07
125 0.07
126 0.08
127 0.07
128 0.07
129 0.11
130 0.13
131 0.16
132 0.16
133 0.19
134 0.2
135 0.22
136 0.25
137 0.23
138 0.22
139 0.24
140 0.28
141 0.31
142 0.36
143 0.41
144 0.45
145 0.49
146 0.51
147 0.48
148 0.49
149 0.47
150 0.42
151 0.4
152 0.33
153 0.3
154 0.29
155 0.31
156 0.3
157 0.28
158 0.28
159 0.33
160 0.42
161 0.43
162 0.49
163 0.57
164 0.62
165 0.69
166 0.77
167 0.79
168 0.8
169 0.86
170 0.89
171 0.9
172 0.91
173 0.92
174 0.93
175 0.94
176 0.94
177 0.93
178 0.93
179 0.91