Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ENJ7

Protein Details
Accession A0A059ENJ7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-117EKEEREKKEKEEKERREKEEKDRKEKENKEKEKEDTAcidic
NLS Segment(s)
PositionSequence
79-113KEKEKEEREKKEKEEKERREKEEKDRKEKENKEKE
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences LNEATNQINKINQEMNDFVEEYKNKCNTIKKDFFLRSIYKLTSELNKKDTLTIYNLSEYDYNRRERIKSLYKEAEIELKEKEKEEREKKEKEEKERREKEEKDRKEKENKEKEKEDTNHSEDIKEEGNLNEEQIKEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.27
4 0.27
5 0.23
6 0.25
7 0.26
8 0.24
9 0.31
10 0.31
11 0.3
12 0.34
13 0.43
14 0.44
15 0.52
16 0.57
17 0.52
18 0.59
19 0.6
20 0.59
21 0.56
22 0.52
23 0.45
24 0.42
25 0.39
26 0.31
27 0.29
28 0.28
29 0.29
30 0.33
31 0.32
32 0.31
33 0.32
34 0.31
35 0.32
36 0.31
37 0.26
38 0.22
39 0.21
40 0.19
41 0.18
42 0.18
43 0.17
44 0.17
45 0.16
46 0.19
47 0.21
48 0.22
49 0.23
50 0.25
51 0.25
52 0.26
53 0.33
54 0.36
55 0.35
56 0.4
57 0.41
58 0.4
59 0.4
60 0.38
61 0.35
62 0.26
63 0.24
64 0.19
65 0.18
66 0.18
67 0.18
68 0.21
69 0.22
70 0.31
71 0.38
72 0.47
73 0.51
74 0.57
75 0.62
76 0.69
77 0.7
78 0.71
79 0.74
80 0.74
81 0.78
82 0.81
83 0.81
84 0.8
85 0.79
86 0.79
87 0.79
88 0.79
89 0.78
90 0.77
91 0.78
92 0.8
93 0.83
94 0.83
95 0.84
96 0.83
97 0.82
98 0.8
99 0.77
100 0.77
101 0.71
102 0.68
103 0.65
104 0.6
105 0.58
106 0.52
107 0.48
108 0.38
109 0.37
110 0.31
111 0.23
112 0.21
113 0.15
114 0.18
115 0.17
116 0.18
117 0.19
118 0.17