Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EHU7

Protein Details
Accession A0A059EHU7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
39-74LKAVKDIKTNPQKKNKKIIKKRKKKINLDEPIKCKSHydrophilic
NLS Segment(s)
PositionSequence
48-107NPQKKNKKIIKKRKKKINLDEPIKCKSVKDPIKSKIKDLKKILKRRINLDKNKVIKTKLK
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046341  SET_dom_sf  
Amino Acid Sequences NKIIIQGNNNLQINYNISVNNEVTFNNKYDANHSSDNSLKAVKDIKTNPQKKNKKIIKKRKKKINLDEPIKCKSVKDPIKSKIKDLKKILKRRINLDKNKVIKTKLKNTFEDTKKIKQRRIHVDEIQENKPLSNVIYEIAQNTIQNEELLESRNYIKERFDTQIEENLEMIKKYCESRGKAEGSKIYAAASKIHGIGIFADEEIQAGQLIIEYVGEKIGKKVADKREKFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.17
4 0.17
5 0.21
6 0.2
7 0.19
8 0.16
9 0.15
10 0.17
11 0.19
12 0.19
13 0.18
14 0.2
15 0.19
16 0.23
17 0.27
18 0.28
19 0.3
20 0.29
21 0.31
22 0.33
23 0.34
24 0.31
25 0.29
26 0.23
27 0.22
28 0.27
29 0.24
30 0.29
31 0.31
32 0.39
33 0.48
34 0.57
35 0.63
36 0.69
37 0.76
38 0.76
39 0.84
40 0.83
41 0.84
42 0.86
43 0.89
44 0.89
45 0.91
46 0.93
47 0.93
48 0.94
49 0.93
50 0.93
51 0.93
52 0.92
53 0.89
54 0.87
55 0.81
56 0.74
57 0.65
58 0.54
59 0.44
60 0.38
61 0.39
62 0.39
63 0.42
64 0.47
65 0.53
66 0.64
67 0.64
68 0.66
69 0.65
70 0.65
71 0.65
72 0.64
73 0.66
74 0.65
75 0.74
76 0.77
77 0.75
78 0.71
79 0.71
80 0.74
81 0.74
82 0.73
83 0.71
84 0.7
85 0.68
86 0.7
87 0.65
88 0.57
89 0.55
90 0.53
91 0.55
92 0.56
93 0.55
94 0.52
95 0.55
96 0.6
97 0.56
98 0.57
99 0.51
100 0.5
101 0.54
102 0.57
103 0.58
104 0.54
105 0.6
106 0.62
107 0.65
108 0.63
109 0.58
110 0.59
111 0.59
112 0.59
113 0.52
114 0.44
115 0.37
116 0.3
117 0.26
118 0.2
119 0.14
120 0.1
121 0.08
122 0.06
123 0.07
124 0.07
125 0.07
126 0.09
127 0.09
128 0.08
129 0.08
130 0.09
131 0.08
132 0.08
133 0.07
134 0.07
135 0.07
136 0.1
137 0.09
138 0.1
139 0.11
140 0.15
141 0.16
142 0.16
143 0.17
144 0.18
145 0.22
146 0.23
147 0.24
148 0.24
149 0.25
150 0.31
151 0.31
152 0.29
153 0.25
154 0.24
155 0.22
156 0.19
157 0.17
158 0.12
159 0.12
160 0.13
161 0.19
162 0.25
163 0.28
164 0.34
165 0.4
166 0.45
167 0.46
168 0.5
169 0.47
170 0.44
171 0.41
172 0.35
173 0.29
174 0.26
175 0.23
176 0.21
177 0.18
178 0.17
179 0.16
180 0.16
181 0.15
182 0.13
183 0.13
184 0.12
185 0.1
186 0.08
187 0.09
188 0.08
189 0.08
190 0.08
191 0.07
192 0.05
193 0.05
194 0.05
195 0.04
196 0.05
197 0.04
198 0.05
199 0.05
200 0.05
201 0.07
202 0.09
203 0.09
204 0.1
205 0.15
206 0.17
207 0.21
208 0.3
209 0.39
210 0.49