Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EV56

Protein Details
Accession A0A059EV56    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
46-78AIKKNRMEKRNDRNKNNPRKKNYDKVKRLYEKGBasic
NLS Segment(s)
PositionSequence
31-97KRKEKQDLLERKVTYAIKKNRMEKRNDRNKNNPRKKNYDKVKRLYEKGENKFNGRIDDKKSKSAKFK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences DDLVENIQEIYEIFNPKLNEESTENEKRNFKRKEKQDLLERKVTYAIKKNRMEKRNDRNKNNPRKKNYDKVKRLYEKGENKFNGRIDDKKSKSAKFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.24
5 0.21
6 0.21
7 0.21
8 0.25
9 0.29
10 0.37
11 0.38
12 0.39
13 0.46
14 0.47
15 0.54
16 0.58
17 0.59
18 0.61
19 0.68
20 0.75
21 0.76
22 0.78
23 0.78
24 0.79
25 0.76
26 0.73
27 0.64
28 0.53
29 0.5
30 0.44
31 0.38
32 0.37
33 0.39
34 0.41
35 0.46
36 0.54
37 0.58
38 0.63
39 0.67
40 0.68
41 0.72
42 0.74
43 0.79
44 0.78
45 0.8
46 0.84
47 0.87
48 0.88
49 0.86
50 0.83
51 0.84
52 0.85
53 0.84
54 0.85
55 0.85
56 0.83
57 0.82
58 0.85
59 0.82
60 0.78
61 0.75
62 0.74
63 0.73
64 0.7
65 0.72
66 0.64
67 0.6
68 0.62
69 0.57
70 0.54
71 0.49
72 0.48
73 0.47
74 0.54
75 0.54
76 0.58
77 0.63