Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ERM3

Protein Details
Accession A0A059ERM3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
83-106NLWLLLKKFKRRKGYSKSRYLKLYHydrophilic
NLS Segment(s)
PositionSequence
90-95KFKRRK
Subcellular Location(s) mito 15, mito_nucl 14.166, nucl 11, cyto_nucl 7.166
Family & Domain DBs
Amino Acid Sequences MGKHVYFKTKFYSNNSSSSSLVQRYLKAGQRTRGYDSIIHKNKHGSYIYYFGENSNKYYHDWVNHSENFVDPETYVHTQNIENLWLLLKKFKRRKGYSKSRYLKLYLAEFDLKRRFYQEESRLFEFLINLTFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.52
4 0.46
5 0.44
6 0.41
7 0.33
8 0.35
9 0.3
10 0.27
11 0.28
12 0.33
13 0.36
14 0.39
15 0.43
16 0.45
17 0.5
18 0.52
19 0.54
20 0.51
21 0.46
22 0.43
23 0.43
24 0.47
25 0.48
26 0.45
27 0.41
28 0.43
29 0.42
30 0.42
31 0.38
32 0.29
33 0.25
34 0.29
35 0.28
36 0.25
37 0.24
38 0.2
39 0.23
40 0.21
41 0.2
42 0.17
43 0.17
44 0.16
45 0.19
46 0.2
47 0.18
48 0.2
49 0.22
50 0.27
51 0.26
52 0.26
53 0.23
54 0.21
55 0.21
56 0.18
57 0.14
58 0.08
59 0.08
60 0.11
61 0.13
62 0.13
63 0.11
64 0.12
65 0.12
66 0.14
67 0.14
68 0.11
69 0.1
70 0.09
71 0.1
72 0.1
73 0.1
74 0.15
75 0.19
76 0.28
77 0.37
78 0.45
79 0.54
80 0.61
81 0.71
82 0.76
83 0.83
84 0.82
85 0.85
86 0.85
87 0.81
88 0.77
89 0.69
90 0.62
91 0.55
92 0.49
93 0.4
94 0.36
95 0.36
96 0.32
97 0.36
98 0.39
99 0.36
100 0.33
101 0.34
102 0.33
103 0.33
104 0.42
105 0.44
106 0.48
107 0.53
108 0.55
109 0.53
110 0.5
111 0.45
112 0.36
113 0.28