Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EQ37

Protein Details
Accession A0A059EQ37    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-62IITHCMKKKHKQISIKERIQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR018999  UPF1_CH/ZBD  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0003723  F:RNA binding  
GO:0003724  F:RNA helicase activity  
GO:0008270  F:zinc ion binding  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
Pfam View protein in Pfam  
PF09416  UPF1_Zn_bind  
PROSITE View protein in PROSITE  
PS51997  UPF1_CH_RICH  
Amino Acid Sequences MIPMEEETILPRCNVCLEASNLVLCLDCDSYLCNNNNGVSSHIITHCMKKKHKQISIKERIQCNLCSDTNLFRLGINLQNEFLCRSCSKEDWKYLINEKCLINEIIESVQINKDKINLTSEDYSSIKKVPVTFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.18
5 0.21
6 0.22
7 0.21
8 0.2
9 0.18
10 0.17
11 0.12
12 0.1
13 0.08
14 0.07
15 0.07
16 0.09
17 0.12
18 0.18
19 0.19
20 0.19
21 0.19
22 0.2
23 0.22
24 0.21
25 0.2
26 0.16
27 0.16
28 0.16
29 0.15
30 0.19
31 0.18
32 0.24
33 0.29
34 0.34
35 0.39
36 0.45
37 0.54
38 0.6
39 0.66
40 0.68
41 0.72
42 0.76
43 0.81
44 0.8
45 0.75
46 0.68
47 0.63
48 0.57
49 0.47
50 0.4
51 0.34
52 0.26
53 0.23
54 0.21
55 0.21
56 0.2
57 0.19
58 0.16
59 0.11
60 0.12
61 0.12
62 0.15
63 0.14
64 0.13
65 0.13
66 0.13
67 0.14
68 0.14
69 0.13
70 0.12
71 0.11
72 0.14
73 0.16
74 0.19
75 0.26
76 0.31
77 0.36
78 0.37
79 0.4
80 0.4
81 0.46
82 0.48
83 0.43
84 0.41
85 0.36
86 0.33
87 0.33
88 0.29
89 0.21
90 0.17
91 0.15
92 0.12
93 0.12
94 0.11
95 0.1
96 0.14
97 0.16
98 0.16
99 0.15
100 0.18
101 0.19
102 0.21
103 0.23
104 0.21
105 0.24
106 0.27
107 0.27
108 0.28
109 0.28
110 0.28
111 0.27
112 0.27
113 0.24
114 0.23