Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EKL2

Protein Details
Accession A0A059EKL2   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-68RYDHKNKGYSYRCNNRNCRGELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences MNIDLIKEPAFFALINTEESAIQLLQNQGLLIKDPVCCNKTMVLRKRYDHKNKGYSYRCNNRNCRGELP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.13
5 0.11
6 0.12
7 0.12
8 0.08
9 0.07
10 0.08
11 0.08
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.06
19 0.07
20 0.08
21 0.09
22 0.13
23 0.14
24 0.15
25 0.15
26 0.18
27 0.25
28 0.33
29 0.4
30 0.45
31 0.49
32 0.52
33 0.6
34 0.67
35 0.7
36 0.7
37 0.71
38 0.72
39 0.73
40 0.8
41 0.78
42 0.77
43 0.77
44 0.78
45 0.77
46 0.77
47 0.8
48 0.8
49 0.81