Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EHK4

Protein Details
Accession A0A059EHK4    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
207-227ITPTGKKKRNFLEKCLKKEIDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16.5, cyto_nucl 13, nucl 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045851  AMP-bd_C_sf  
IPR000873  AMP-dep_Synth/Lig_com  
IPR042099  ANL_N_sf  
Pfam View protein in Pfam  
PF00501  AMP-binding  
Amino Acid Sequences APISTDTVKFLQACFSCKIFQGYGQTETTAACIVAPMEETTVDTVGIPFPQNLIKLAPIGDNKCEIWVKGENVFKGYYKNEEATKECFEDGWFKTGDIGEVKNNLFKIVGRNKEIFKTSQGEYIVPEKVENVYMNSLIEDIFIVGRSTEDYIVAIVVCTSNASSDSVIKKILDIGNKAVYDKKIPRYEIPRRVLVRRTPFIDFGEVITPTGKKKRNFLEKCLKKEIDELYSKNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.28
4 0.29
5 0.33
6 0.26
7 0.28
8 0.32
9 0.32
10 0.33
11 0.33
12 0.31
13 0.27
14 0.26
15 0.23
16 0.16
17 0.12
18 0.07
19 0.07
20 0.06
21 0.06
22 0.07
23 0.07
24 0.07
25 0.07
26 0.08
27 0.09
28 0.09
29 0.08
30 0.07
31 0.07
32 0.08
33 0.09
34 0.09
35 0.08
36 0.09
37 0.11
38 0.12
39 0.12
40 0.13
41 0.12
42 0.12
43 0.13
44 0.16
45 0.18
46 0.2
47 0.2
48 0.21
49 0.2
50 0.23
51 0.23
52 0.19
53 0.18
54 0.21
55 0.21
56 0.25
57 0.28
58 0.25
59 0.27
60 0.28
61 0.24
62 0.23
63 0.22
64 0.21
65 0.2
66 0.22
67 0.23
68 0.25
69 0.27
70 0.28
71 0.29
72 0.25
73 0.23
74 0.21
75 0.19
76 0.21
77 0.2
78 0.18
79 0.16
80 0.15
81 0.16
82 0.16
83 0.16
84 0.12
85 0.12
86 0.1
87 0.13
88 0.13
89 0.14
90 0.14
91 0.13
92 0.11
93 0.11
94 0.18
95 0.22
96 0.26
97 0.27
98 0.3
99 0.31
100 0.33
101 0.34
102 0.28
103 0.23
104 0.22
105 0.2
106 0.21
107 0.21
108 0.18
109 0.18
110 0.19
111 0.18
112 0.14
113 0.13
114 0.1
115 0.1
116 0.11
117 0.1
118 0.08
119 0.08
120 0.09
121 0.09
122 0.08
123 0.08
124 0.06
125 0.06
126 0.05
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.04
143 0.04
144 0.03
145 0.04
146 0.04
147 0.04
148 0.05
149 0.06
150 0.07
151 0.11
152 0.13
153 0.14
154 0.15
155 0.15
156 0.14
157 0.18
158 0.2
159 0.2
160 0.2
161 0.23
162 0.26
163 0.26
164 0.27
165 0.26
166 0.25
167 0.28
168 0.32
169 0.38
170 0.4
171 0.43
172 0.49
173 0.55
174 0.64
175 0.67
176 0.66
177 0.65
178 0.64
179 0.66
180 0.66
181 0.65
182 0.64
183 0.6
184 0.59
185 0.54
186 0.52
187 0.48
188 0.45
189 0.36
190 0.29
191 0.27
192 0.23
193 0.2
194 0.19
195 0.18
196 0.19
197 0.28
198 0.33
199 0.33
200 0.42
201 0.51
202 0.61
203 0.66
204 0.71
205 0.74
206 0.76
207 0.81
208 0.82
209 0.73
210 0.64
211 0.64
212 0.59
213 0.56
214 0.54