Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ELS3

Protein Details
Accession A0A059ELS3    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-54RLSVSHTTRKKREKETDHREYHFBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008145  GK/Ca_channel_bsu  
IPR008144  Guanylate_kin-like_dom  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF00625  Guanylate_kin  
PROSITE View protein in PROSITE  
PS50052  GUANYLATE_KINASE_2  
CDD cd00071  GMPK  
Amino Acid Sequences MLPKRIIISGASGSGKSTVINYLLENYPEKFRLSVSHTTRKKREKETDHREYHFISKEEFLRKIENNEMFEYQIFNNEYYGTSFAELNSCDKTTLFDLGKVGVEIARQNCISGIYISILCSHDLLLSNLIHRVGSENLNDKTLNDIYGRLEEYKRDESFFT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.14
4 0.13
5 0.11
6 0.12
7 0.13
8 0.12
9 0.15
10 0.16
11 0.18
12 0.19
13 0.19
14 0.21
15 0.21
16 0.22
17 0.18
18 0.18
19 0.21
20 0.24
21 0.32
22 0.36
23 0.45
24 0.51
25 0.59
26 0.68
27 0.72
28 0.74
29 0.74
30 0.77
31 0.78
32 0.82
33 0.83
34 0.85
35 0.82
36 0.77
37 0.69
38 0.61
39 0.56
40 0.5
41 0.4
42 0.32
43 0.28
44 0.3
45 0.32
46 0.31
47 0.27
48 0.27
49 0.27
50 0.29
51 0.32
52 0.31
53 0.29
54 0.29
55 0.28
56 0.24
57 0.23
58 0.21
59 0.15
60 0.15
61 0.13
62 0.11
63 0.11
64 0.11
65 0.11
66 0.1
67 0.11
68 0.08
69 0.07
70 0.07
71 0.07
72 0.08
73 0.08
74 0.09
75 0.09
76 0.1
77 0.09
78 0.09
79 0.11
80 0.11
81 0.15
82 0.13
83 0.13
84 0.13
85 0.14
86 0.14
87 0.12
88 0.11
89 0.07
90 0.07
91 0.09
92 0.1
93 0.12
94 0.11
95 0.12
96 0.12
97 0.12
98 0.12
99 0.1
100 0.1
101 0.09
102 0.09
103 0.09
104 0.11
105 0.11
106 0.1
107 0.1
108 0.1
109 0.1
110 0.11
111 0.11
112 0.12
113 0.12
114 0.12
115 0.14
116 0.13
117 0.12
118 0.11
119 0.13
120 0.12
121 0.15
122 0.18
123 0.23
124 0.24
125 0.26
126 0.26
127 0.24
128 0.27
129 0.25
130 0.23
131 0.17
132 0.17
133 0.18
134 0.21
135 0.23
136 0.21
137 0.22
138 0.23
139 0.29
140 0.35
141 0.34