Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EI97

Protein Details
Accession A0A059EI97    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
18-43VKNMCNRRSSPKIKKKKEAEKTVEEKHydrophilic
NLS Segment(s)
PositionSequence
26-35SSPKIKKKKE
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035896  AN1-like_Znf  
IPR000058  Znf_AN1  
Gene Ontology GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF01428  zf-AN1  
PROSITE View protein in PROSITE  
PS51039  ZF_AN1  
Amino Acid Sequences MLPQTSSEEEELVVMRNVKNMCNRRSSPKIKKKKEAEKTVEEKCYKCGKILRPTNKFGCRCGNVFCMVHRFSDQHNCSFNFKAFSVKKLRQENPQVINKKVTEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.17
4 0.18
5 0.21
6 0.29
7 0.36
8 0.38
9 0.44
10 0.47
11 0.51
12 0.6
13 0.67
14 0.69
15 0.72
16 0.79
17 0.8
18 0.87
19 0.88
20 0.89
21 0.89
22 0.88
23 0.84
24 0.82
25 0.79
26 0.75
27 0.72
28 0.64
29 0.54
30 0.48
31 0.48
32 0.4
33 0.37
34 0.37
35 0.37
36 0.44
37 0.53
38 0.58
39 0.56
40 0.61
41 0.64
42 0.66
43 0.6
44 0.54
45 0.51
46 0.44
47 0.41
48 0.39
49 0.34
50 0.29
51 0.28
52 0.26
53 0.25
54 0.23
55 0.22
56 0.2
57 0.2
58 0.2
59 0.3
60 0.31
61 0.3
62 0.34
63 0.35
64 0.38
65 0.39
66 0.38
67 0.31
68 0.29
69 0.33
70 0.3
71 0.35
72 0.4
73 0.44
74 0.51
75 0.57
76 0.61
77 0.61
78 0.7
79 0.72
80 0.71
81 0.75
82 0.71
83 0.65
84 0.67