Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ETU3

Protein Details
Accession A0A059ETU3   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKIERKSKKTTNKLINAKLPTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR013025  Ribosomal_L25/23  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00276  Ribosomal_L23  
Amino Acid Sequences MKIERKSKKTTNKLINAKLPTDSASLIKYGINNERTARMMEKDNTLVFACVIEATKPQIKAAVEKLYSCKVKKVRTCITFKGYKKAFVVMQEEGEAIRVANAANII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.76
4 0.67
5 0.58
6 0.48
7 0.4
8 0.32
9 0.26
10 0.19
11 0.16
12 0.14
13 0.13
14 0.13
15 0.12
16 0.14
17 0.2
18 0.2
19 0.21
20 0.22
21 0.24
22 0.24
23 0.25
24 0.23
25 0.19
26 0.22
27 0.21
28 0.23
29 0.23
30 0.21
31 0.21
32 0.19
33 0.17
34 0.12
35 0.1
36 0.08
37 0.06
38 0.06
39 0.05
40 0.05
41 0.07
42 0.1
43 0.1
44 0.1
45 0.13
46 0.13
47 0.16
48 0.19
49 0.23
50 0.2
51 0.21
52 0.24
53 0.27
54 0.31
55 0.29
56 0.33
57 0.33
58 0.41
59 0.46
60 0.52
61 0.56
62 0.6
63 0.66
64 0.64
65 0.64
66 0.65
67 0.62
68 0.63
69 0.55
70 0.52
71 0.47
72 0.45
73 0.4
74 0.36
75 0.39
76 0.3
77 0.3
78 0.25
79 0.24
80 0.2
81 0.19
82 0.14
83 0.09
84 0.08
85 0.07
86 0.06