Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ES58

Protein Details
Accession A0A059ES58    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
19-43PETQKVKPEEEKKRKVKQEEGKRIVBasic
NLS Segment(s)
PositionSequence
13-41IKKKKAPETQKVKPEEEKKRKVKQEEGKR
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001387  Cro/C1-type_HTH  
IPR010982  Lambda_DNA-bd_dom_sf  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF01381  HTH_3  
PROSITE View protein in PROSITE  
PS50943  HTH_CROC1  
CDD cd00093  HTH_XRE  
Amino Acid Sequences MGLESDSRKVIIIKKKKAPETQKVKPEEEKKRKVKQEEGKRIVDARMKANLKQVDLARKSNLTVATISKWEKGEDVFDKKVAAKIAKVLNIKFDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.71
4 0.77
5 0.79
6 0.79
7 0.79
8 0.79
9 0.78
10 0.75
11 0.72
12 0.71
13 0.71
14 0.72
15 0.73
16 0.74
17 0.75
18 0.79
19 0.82
20 0.8
21 0.8
22 0.79
23 0.8
24 0.81
25 0.77
26 0.7
27 0.63
28 0.58
29 0.51
30 0.45
31 0.35
32 0.26
33 0.28
34 0.27
35 0.27
36 0.32
37 0.31
38 0.27
39 0.29
40 0.28
41 0.3
42 0.32
43 0.33
44 0.28
45 0.27
46 0.27
47 0.27
48 0.25
49 0.17
50 0.16
51 0.15
52 0.15
53 0.19
54 0.19
55 0.19
56 0.19
57 0.19
58 0.18
59 0.18
60 0.22
61 0.25
62 0.3
63 0.29
64 0.28
65 0.3
66 0.3
67 0.32
68 0.31
69 0.26
70 0.21
71 0.26
72 0.31
73 0.36
74 0.4
75 0.37