Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EKM1

Protein Details
Accession A0A059EKM1   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MKEQKIPRKIKKLYERQNRFEVEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 12, cyto 3.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007180  DUF382  
IPR006568  PSP_pro-rich  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF04037  DUF382  
PF04046  PSP  
Amino Acid Sequences MKEQKIPRKIKKLYERQNRFEVEKIKSNYPEHLTIEDIDSSDMELLTKCKSVDNSIPVPFFWKYKKVNPIYKLNVPFIVPSIIKEKEFTLSLDEMIKNIPRKRIIGYGELTREGYSFKTQLKSMKPGYMSMELISALNLKEGVKYPWYDKIEYFGIPTHFSDAKLDDFIVKIYSDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.83
4 0.84
5 0.78
6 0.71
7 0.67
8 0.63
9 0.57
10 0.57
11 0.55
12 0.53
13 0.54
14 0.53
15 0.52
16 0.49
17 0.47
18 0.4
19 0.38
20 0.33
21 0.28
22 0.28
23 0.22
24 0.18
25 0.14
26 0.11
27 0.1
28 0.09
29 0.08
30 0.06
31 0.06
32 0.07
33 0.08
34 0.1
35 0.1
36 0.11
37 0.13
38 0.17
39 0.22
40 0.27
41 0.3
42 0.31
43 0.31
44 0.29
45 0.31
46 0.28
47 0.25
48 0.22
49 0.25
50 0.27
51 0.33
52 0.43
53 0.47
54 0.54
55 0.57
56 0.63
57 0.61
58 0.63
59 0.59
60 0.51
61 0.44
62 0.36
63 0.31
64 0.23
65 0.2
66 0.13
67 0.11
68 0.14
69 0.14
70 0.14
71 0.15
72 0.14
73 0.13
74 0.14
75 0.13
76 0.12
77 0.11
78 0.11
79 0.13
80 0.12
81 0.11
82 0.11
83 0.14
84 0.16
85 0.18
86 0.22
87 0.22
88 0.23
89 0.26
90 0.3
91 0.3
92 0.29
93 0.3
94 0.29
95 0.29
96 0.28
97 0.27
98 0.21
99 0.18
100 0.15
101 0.14
102 0.12
103 0.13
104 0.15
105 0.17
106 0.19
107 0.25
108 0.29
109 0.34
110 0.34
111 0.36
112 0.34
113 0.34
114 0.36
115 0.33
116 0.3
117 0.23
118 0.21
119 0.17
120 0.16
121 0.14
122 0.11
123 0.07
124 0.07
125 0.08
126 0.07
127 0.09
128 0.1
129 0.13
130 0.14
131 0.17
132 0.19
133 0.27
134 0.31
135 0.31
136 0.3
137 0.32
138 0.32
139 0.3
140 0.29
141 0.24
142 0.23
143 0.23
144 0.23
145 0.24
146 0.23
147 0.23
148 0.24
149 0.22
150 0.22
151 0.21
152 0.21
153 0.17
154 0.17
155 0.17
156 0.16