Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EJ22

Protein Details
Accession A0A059EJ22   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
94-120MGQMLLKKEKKHEKKRNFLLRRSGGCCHydrophilic
NLS Segment(s)
PositionSequence
100-109KKEKKHEKKR
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR001806  Small_GTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
CDD cd00154  Rab  
Amino Acid Sequences RFKALTRAYYRGAQGVFIVFDLTDVGSRNSVPAWIKDVESHVEENIPRMLVGNKLDRFTGSLVEMEEFAKEMETPFIAVSAKAVINIDNMFKRMGQMLLKKEKKHEKKRNFLLRRSGGCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.18
4 0.14
5 0.13
6 0.08
7 0.07
8 0.07
9 0.07
10 0.06
11 0.07
12 0.08
13 0.08
14 0.08
15 0.09
16 0.09
17 0.12
18 0.12
19 0.12
20 0.15
21 0.16
22 0.16
23 0.17
24 0.19
25 0.18
26 0.19
27 0.18
28 0.14
29 0.15
30 0.15
31 0.15
32 0.14
33 0.11
34 0.09
35 0.09
36 0.1
37 0.1
38 0.13
39 0.18
40 0.19
41 0.19
42 0.19
43 0.18
44 0.19
45 0.17
46 0.15
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.07
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.07
72 0.09
73 0.1
74 0.12
75 0.11
76 0.13
77 0.13
78 0.12
79 0.13
80 0.13
81 0.15
82 0.18
83 0.23
84 0.31
85 0.41
86 0.47
87 0.49
88 0.57
89 0.66
90 0.71
91 0.76
92 0.79
93 0.79
94 0.84
95 0.92
96 0.94
97 0.92
98 0.89
99 0.88
100 0.87