Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EHM9

Protein Details
Accession A0A059EHM9    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-74LKAVKDIKSNPQKKNKKIIKKRKKKINLNEPIKCKSHydrophilic
NLS Segment(s)
PositionSequence
46-107KSNPQKKNKKIIKKRKKKINLNEPIKCKSVKDPIKSKIKDLKKILKRRINLDKNKVIKTKLK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046341  SET_dom_sf  
Amino Acid Sequences NKIIIQDNNNLQINYNISVNNEETFNNKYDANHSSDNSLKAVKDIKSNPQKKNKKIIKKRKKKINLNEPIKCKSVKDPIKSKIKDLKKILKRRINLDKNKVIKTKLKNTFEDTKKIKQRRIHVDEIQENKPLSNVIYEIAQNTIQNEELLESRNYIKERFDTQIEENLEMIKKYCENRGKAEGSKIYAAASKIHGIGIFADEEIQAGQLIIEYVGEKIGKKVADKREKFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.18
4 0.17
5 0.2
6 0.21
7 0.19
8 0.17
9 0.16
10 0.17
11 0.2
12 0.2
13 0.19
14 0.19
15 0.19
16 0.22
17 0.25
18 0.28
19 0.29
20 0.28
21 0.31
22 0.33
23 0.34
24 0.31
25 0.29
26 0.23
27 0.22
28 0.27
29 0.24
30 0.29
31 0.31
32 0.39
33 0.48
34 0.57
35 0.63
36 0.69
37 0.76
38 0.76
39 0.84
40 0.83
41 0.84
42 0.86
43 0.89
44 0.89
45 0.91
46 0.93
47 0.93
48 0.94
49 0.93
50 0.93
51 0.93
52 0.92
53 0.91
54 0.88
55 0.83
56 0.76
57 0.68
58 0.58
59 0.48
60 0.44
61 0.44
62 0.44
63 0.46
64 0.51
65 0.57
66 0.66
67 0.66
68 0.66
69 0.65
70 0.65
71 0.65
72 0.64
73 0.66
74 0.65
75 0.74
76 0.77
77 0.75
78 0.71
79 0.71
80 0.74
81 0.74
82 0.73
83 0.71
84 0.7
85 0.68
86 0.7
87 0.65
88 0.57
89 0.55
90 0.53
91 0.55
92 0.56
93 0.55
94 0.52
95 0.55
96 0.6
97 0.56
98 0.57
99 0.51
100 0.5
101 0.54
102 0.57
103 0.58
104 0.54
105 0.6
106 0.62
107 0.65
108 0.63
109 0.58
110 0.59
111 0.59
112 0.59
113 0.52
114 0.44
115 0.37
116 0.3
117 0.26
118 0.2
119 0.14
120 0.1
121 0.08
122 0.06
123 0.07
124 0.07
125 0.07
126 0.09
127 0.09
128 0.08
129 0.08
130 0.09
131 0.08
132 0.08
133 0.07
134 0.07
135 0.07
136 0.1
137 0.09
138 0.1
139 0.11
140 0.15
141 0.16
142 0.16
143 0.17
144 0.18
145 0.22
146 0.23
147 0.24
148 0.24
149 0.25
150 0.31
151 0.31
152 0.29
153 0.25
154 0.24
155 0.22
156 0.19
157 0.17
158 0.12
159 0.14
160 0.15
161 0.24
162 0.29
163 0.32
164 0.38
165 0.44
166 0.48
167 0.47
168 0.53
169 0.47
170 0.43
171 0.41
172 0.35
173 0.29
174 0.27
175 0.24
176 0.2
177 0.18
178 0.17
179 0.16
180 0.16
181 0.15
182 0.13
183 0.13
184 0.12
185 0.1
186 0.08
187 0.09
188 0.08
189 0.08
190 0.08
191 0.07
192 0.05
193 0.05
194 0.05
195 0.04
196 0.05
197 0.04
198 0.05
199 0.05
200 0.05
201 0.07
202 0.09
203 0.09
204 0.1
205 0.15
206 0.17
207 0.21
208 0.3
209 0.39
210 0.49