Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EGB5

Protein Details
Accession A0A059EGB5    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
34-96LEEETKEREKNRKKKKNSEEKKKKIKKTVEVNSDEIEAKNKKKSKKSSKKKEEPKEEKIKKTVBasic
NLS Segment(s)
PositionSequence
39-62KEREKNRKKKKNSEEKKKKIKKTV
70-95EAKNKKKSKKSSKKKEEPKEEKIKKT
Subcellular Location(s) nucl 18, cyto_nucl 12.5, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences LSNFFSSIFRSCRREKEEETDTSPVNYLSEISKLEEETKEREKNRKKKKNSEEKKKKIKKTVEVNSDEIEAKNKKKSKKSSKKKEEPKEEKIKKTVVNKTKNKTIPSIEDSFFGSAEDHNYTPFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.58
3 0.61
4 0.62
5 0.61
6 0.61
7 0.55
8 0.48
9 0.42
10 0.37
11 0.28
12 0.21
13 0.16
14 0.12
15 0.09
16 0.1
17 0.1
18 0.12
19 0.12
20 0.13
21 0.15
22 0.17
23 0.18
24 0.21
25 0.28
26 0.33
27 0.36
28 0.46
29 0.54
30 0.62
31 0.71
32 0.76
33 0.78
34 0.82
35 0.89
36 0.91
37 0.91
38 0.92
39 0.92
40 0.92
41 0.94
42 0.93
43 0.89
44 0.87
45 0.84
46 0.81
47 0.8
48 0.78
49 0.76
50 0.7
51 0.64
52 0.55
53 0.48
54 0.4
55 0.3
56 0.26
57 0.2
58 0.19
59 0.24
60 0.29
61 0.34
62 0.43
63 0.54
64 0.61
65 0.69
66 0.78
67 0.82
68 0.88
69 0.92
70 0.94
71 0.94
72 0.94
73 0.92
74 0.9
75 0.9
76 0.87
77 0.83
78 0.77
79 0.71
80 0.66
81 0.66
82 0.67
83 0.65
84 0.67
85 0.7
86 0.72
87 0.76
88 0.76
89 0.7
90 0.65
91 0.61
92 0.58
93 0.56
94 0.54
95 0.45
96 0.4
97 0.39
98 0.34
99 0.29
100 0.22
101 0.16
102 0.11
103 0.14
104 0.17
105 0.15