Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EF53

Protein Details
Accession A0A059EF53    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
36-74FIFCRSKCLKLFKRKLNPRKTKWTKTYRMLKKKSLTNDEHydrophilic
NLS Segment(s)
PositionSequence
48-60KRKLNPRKTKWTK
Subcellular Location(s) mito 20, mito_nucl 13.333, nucl 4.5, cyto_nucl 3.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences FYFLFKSMRIEKCWFCSCNVYPGHGSSFARNDGKLFIFCRSKCLKLFKRKLNPRKTKWTKTYRMLKKKSLTNDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.42
3 0.45
4 0.41
5 0.43
6 0.4
7 0.36
8 0.31
9 0.31
10 0.31
11 0.27
12 0.26
13 0.21
14 0.22
15 0.23
16 0.23
17 0.21
18 0.19
19 0.18
20 0.18
21 0.17
22 0.16
23 0.16
24 0.2
25 0.2
26 0.26
27 0.27
28 0.29
29 0.32
30 0.41
31 0.46
32 0.52
33 0.61
34 0.65
35 0.73
36 0.81
37 0.87
38 0.88
39 0.9
40 0.87
41 0.89
42 0.89
43 0.88
44 0.87
45 0.88
46 0.86
47 0.85
48 0.88
49 0.88
50 0.88
51 0.86
52 0.85
53 0.82
54 0.81