Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WKS1

Protein Details
Accession B2WKS1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-35GKKSYVFATKSKPKPKPKHSKASKKEKSILQHydrophilic
NLS Segment(s)
PositionSequence
14-31KSKPKPKPKHSKASKKEK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.333, mito_nucl 12.666, cyto 3
Family & Domain DBs
Amino Acid Sequences MAHNGKKSYVFATKSKPKPKPKHSKASKKEKSILQSAPLLNHDANFNKDGLIEGTVVTEASVSQTNGFPCQDELTKDTGKPDNKSTLSVTSAIIPMSQLTTTVTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.68
3 0.72
4 0.75
5 0.82
6 0.88
7 0.9
8 0.89
9 0.91
10 0.91
11 0.93
12 0.92
13 0.93
14 0.9
15 0.87
16 0.84
17 0.78
18 0.72
19 0.68
20 0.6
21 0.51
22 0.48
23 0.4
24 0.35
25 0.31
26 0.28
27 0.21
28 0.19
29 0.18
30 0.14
31 0.15
32 0.14
33 0.13
34 0.11
35 0.11
36 0.11
37 0.09
38 0.09
39 0.07
40 0.06
41 0.06
42 0.06
43 0.05
44 0.05
45 0.04
46 0.03
47 0.04
48 0.05
49 0.05
50 0.06
51 0.08
52 0.09
53 0.11
54 0.11
55 0.11
56 0.11
57 0.13
58 0.13
59 0.14
60 0.16
61 0.19
62 0.21
63 0.2
64 0.24
65 0.29
66 0.32
67 0.34
68 0.36
69 0.39
70 0.39
71 0.41
72 0.4
73 0.36
74 0.34
75 0.32
76 0.27
77 0.21
78 0.21
79 0.18
80 0.15
81 0.12
82 0.1
83 0.11
84 0.1
85 0.08