Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EUH4

Protein Details
Accession A0A059EUH4   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-65ENLWLQLKKYKRKKGYSKSRYLKYYLHydrophilic
NLS Segment(s)
PositionSequence
50-53KRKK
Subcellular Location(s) nucl 16, cyto_nucl 12.333, mito_nucl 11.499, mito 5.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MFSSYIHYFAENREKYRHDFVNHSTNFIDPVSSTHTQNIENLWLQLKKYKRKKGYSKSRYLKYYLSEFELKKDFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.49
4 0.49
5 0.42
6 0.44
7 0.45
8 0.51
9 0.47
10 0.45
11 0.38
12 0.32
13 0.3
14 0.24
15 0.19
16 0.09
17 0.1
18 0.14
19 0.15
20 0.15
21 0.16
22 0.17
23 0.17
24 0.18
25 0.17
26 0.13
27 0.12
28 0.12
29 0.13
30 0.12
31 0.12
32 0.17
33 0.24
34 0.32
35 0.41
36 0.51
37 0.58
38 0.67
39 0.78
40 0.83
41 0.88
42 0.88
43 0.89
44 0.89
45 0.88
46 0.82
47 0.75
48 0.68
49 0.61
50 0.58
51 0.5
52 0.46
53 0.45
54 0.41
55 0.43