Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WIL7

Protein Details
Accession B2WIL7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
274-309MYMISVKRQRKLKMKKHKYKKLMKRTRLLRRKLDRTBasic
NLS Segment(s)
PositionSequence
280-308KRQRKLKMKKHKYKKLMKRTRLLRRKLDR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFSPAVGRVARSANTLSTAAFARCALNACARSALTSTAPQQPLHQRRYSSSKPLTPPNSKKKPAGIDQNATAELQGAGKRSKELGRVEKQSTATIGKNVPYVAPTNHLREDDVKLSAFFGLHRPISISRSFPNAVSPAEFDAFFDVDRSSSINKMKTTQQVLSGFLRRVQDEMDVQEEQRADAALAEQEVYHLDGQLTQERVESWAADLHPFQPPPAPEPYDAVANVPASEPESYSAERLSASINERVTEVPLPSDESGPRTFREHVEQRRYGMYMISVKRQRKLKMKKHKYKKLMKRTRLLRRKLDRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.18
5 0.19
6 0.16
7 0.16
8 0.15
9 0.13
10 0.14
11 0.17
12 0.17
13 0.22
14 0.23
15 0.23
16 0.25
17 0.24
18 0.24
19 0.22
20 0.23
21 0.18
22 0.2
23 0.22
24 0.28
25 0.31
26 0.3
27 0.35
28 0.43
29 0.5
30 0.53
31 0.54
32 0.48
33 0.52
34 0.6
35 0.6
36 0.59
37 0.58
38 0.59
39 0.59
40 0.66
41 0.69
42 0.71
43 0.75
44 0.76
45 0.78
46 0.76
47 0.75
48 0.73
49 0.72
50 0.69
51 0.7
52 0.66
53 0.61
54 0.59
55 0.57
56 0.5
57 0.42
58 0.34
59 0.23
60 0.16
61 0.13
62 0.12
63 0.12
64 0.13
65 0.13
66 0.14
67 0.17
68 0.2
69 0.24
70 0.3
71 0.37
72 0.43
73 0.49
74 0.5
75 0.52
76 0.5
77 0.45
78 0.39
79 0.33
80 0.27
81 0.24
82 0.23
83 0.2
84 0.19
85 0.19
86 0.16
87 0.14
88 0.15
89 0.13
90 0.17
91 0.18
92 0.21
93 0.23
94 0.23
95 0.23
96 0.24
97 0.27
98 0.23
99 0.22
100 0.18
101 0.16
102 0.16
103 0.15
104 0.12
105 0.09
106 0.1
107 0.12
108 0.11
109 0.11
110 0.13
111 0.14
112 0.17
113 0.18
114 0.17
115 0.15
116 0.2
117 0.2
118 0.19
119 0.2
120 0.18
121 0.17
122 0.16
123 0.15
124 0.12
125 0.12
126 0.12
127 0.1
128 0.09
129 0.09
130 0.08
131 0.08
132 0.06
133 0.06
134 0.06
135 0.07
136 0.07
137 0.1
138 0.13
139 0.16
140 0.16
141 0.19
142 0.23
143 0.27
144 0.3
145 0.27
146 0.3
147 0.28
148 0.3
149 0.3
150 0.29
151 0.24
152 0.23
153 0.24
154 0.18
155 0.17
156 0.15
157 0.14
158 0.12
159 0.13
160 0.13
161 0.12
162 0.12
163 0.14
164 0.13
165 0.11
166 0.1
167 0.09
168 0.06
169 0.06
170 0.06
171 0.04
172 0.05
173 0.05
174 0.04
175 0.04
176 0.05
177 0.06
178 0.05
179 0.05
180 0.05
181 0.07
182 0.08
183 0.12
184 0.13
185 0.12
186 0.12
187 0.12
188 0.14
189 0.13
190 0.11
191 0.08
192 0.1
193 0.11
194 0.12
195 0.12
196 0.12
197 0.16
198 0.16
199 0.15
200 0.16
201 0.17
202 0.19
203 0.23
204 0.24
205 0.21
206 0.24
207 0.25
208 0.23
209 0.22
210 0.2
211 0.17
212 0.14
213 0.14
214 0.11
215 0.1
216 0.09
217 0.09
218 0.09
219 0.09
220 0.12
221 0.13
222 0.13
223 0.13
224 0.12
225 0.12
226 0.12
227 0.12
228 0.12
229 0.15
230 0.19
231 0.19
232 0.19
233 0.2
234 0.2
235 0.2
236 0.19
237 0.16
238 0.13
239 0.13
240 0.17
241 0.17
242 0.19
243 0.18
244 0.2
245 0.23
246 0.24
247 0.25
248 0.25
249 0.27
250 0.28
251 0.36
252 0.42
253 0.48
254 0.56
255 0.57
256 0.56
257 0.57
258 0.55
259 0.45
260 0.37
261 0.31
262 0.3
263 0.3
264 0.37
265 0.41
266 0.45
267 0.51
268 0.57
269 0.61
270 0.63
271 0.72
272 0.73
273 0.77
274 0.84
275 0.88
276 0.92
277 0.95
278 0.95
279 0.95
280 0.95
281 0.95
282 0.94
283 0.93
284 0.92
285 0.92
286 0.92
287 0.92
288 0.9
289 0.89