Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EL24

Protein Details
Accession A0A059EL24   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
97-125DNPTPCTCFKKCRKKEHRNQKKGFDKEEAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 4
Family & Domain DBs
Amino Acid Sequences YNKHATLENEFIDSLTYLDGNKERDRNWENENDEIIVHQDDESYFYSFNYRRYLDHTLNEYLFLKNNPNELEEWYKSKARTFQTDQLLWLTQPINDDNPTPCTCFKKCRKKEHRNQKKGFDKEEANKEISKFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.1
3 0.09
4 0.07
5 0.1
6 0.14
7 0.17
8 0.22
9 0.25
10 0.26
11 0.34
12 0.39
13 0.39
14 0.41
15 0.45
16 0.43
17 0.42
18 0.42
19 0.34
20 0.29
21 0.25
22 0.22
23 0.14
24 0.11
25 0.08
26 0.07
27 0.07
28 0.1
29 0.11
30 0.11
31 0.1
32 0.1
33 0.16
34 0.16
35 0.19
36 0.21
37 0.2
38 0.2
39 0.26
40 0.32
41 0.3
42 0.32
43 0.33
44 0.31
45 0.3
46 0.3
47 0.26
48 0.19
49 0.18
50 0.15
51 0.15
52 0.13
53 0.15
54 0.15
55 0.15
56 0.15
57 0.16
58 0.21
59 0.19
60 0.21
61 0.21
62 0.23
63 0.23
64 0.25
65 0.28
66 0.26
67 0.32
68 0.36
69 0.4
70 0.44
71 0.44
72 0.43
73 0.38
74 0.36
75 0.28
76 0.24
77 0.17
78 0.12
79 0.13
80 0.13
81 0.14
82 0.14
83 0.16
84 0.16
85 0.2
86 0.21
87 0.22
88 0.24
89 0.28
90 0.3
91 0.39
92 0.48
93 0.54
94 0.62
95 0.71
96 0.79
97 0.85
98 0.93
99 0.94
100 0.95
101 0.95
102 0.93
103 0.93
104 0.92
105 0.88
106 0.83
107 0.79
108 0.76
109 0.74
110 0.75
111 0.69
112 0.62
113 0.57