Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ETH8

Protein Details
Accession A0A059ETH8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
17-36HTKTVRCRSKEQRRVRYGGPBasic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 2.5, cyto_nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MPRFFHKTQYCVSCAVHTKTVRCRSKEQRRVRYGGPKVSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.36
4 0.33
5 0.35
6 0.41
7 0.5
8 0.51
9 0.49
10 0.55
11 0.6
12 0.69
13 0.75
14 0.78
15 0.78
16 0.8
17 0.81
18 0.8
19 0.79
20 0.76