Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ET67

Protein Details
Accession A0A059ET67    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
49-75QFNKKNRTENVKKKKELKKIEKETKVVHydrophilic
NLS Segment(s)
PositionSequence
22-70VKLAKKEVRAANKKRILARKLHGMKAIQFNKKNRTENVKKKKELKKIEK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
Amino Acid Sequences MAQNNFVEDTIKKNGRALNHEVKLAKKEVRAANKKRILARKLHGMKAIQFNKKNRTENVKKKKELKKIEKETKVVTPTSGEALPHFLLDRNIQTKSSDKEQNVMQVKKTKVNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.42
4 0.45
5 0.46
6 0.44
7 0.48
8 0.47
9 0.46
10 0.45
11 0.43
12 0.38
13 0.3
14 0.35
15 0.38
16 0.46
17 0.54
18 0.57
19 0.63
20 0.66
21 0.68
22 0.68
23 0.7
24 0.63
25 0.6
26 0.57
27 0.57
28 0.56
29 0.54
30 0.5
31 0.43
32 0.43
33 0.45
34 0.49
35 0.45
36 0.46
37 0.48
38 0.53
39 0.59
40 0.58
41 0.52
42 0.55
43 0.58
44 0.63
45 0.69
46 0.7
47 0.69
48 0.75
49 0.8
50 0.8
51 0.81
52 0.8
53 0.8
54 0.82
55 0.86
56 0.82
57 0.76
58 0.7
59 0.64
60 0.57
61 0.46
62 0.36
63 0.27
64 0.22
65 0.22
66 0.19
67 0.14
68 0.11
69 0.15
70 0.14
71 0.13
72 0.13
73 0.11
74 0.12
75 0.15
76 0.2
77 0.2
78 0.21
79 0.21
80 0.23
81 0.28
82 0.31
83 0.36
84 0.38
85 0.36
86 0.39
87 0.41
88 0.48
89 0.51
90 0.49
91 0.48
92 0.48
93 0.51