Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EMC6

Protein Details
Accession A0A059EMC6    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-116LKAPTEKKSKHEKESFKPKEKVTKABasic
NLS Segment(s)
PositionSequence
61-70KKGEKKTEKK
96-122TEKKSKHEKESFKPKEKVTKAESRKKY
Subcellular Location(s) nucl 17, cyto_nucl 11.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MLKEGTCIFSGHDVPKGSGLIKVTNDTRSFVFKNQKVLKLVERKINPKDIAWTQASRILHKKGEKKTEKKNVEIRIIKEVRGFPGVSSDLVLKAPTEKKSKHEKESFKPKEKVTKAESRKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.25
4 0.22
5 0.2
6 0.2
7 0.18
8 0.18
9 0.22
10 0.22
11 0.26
12 0.27
13 0.26
14 0.26
15 0.27
16 0.28
17 0.31
18 0.38
19 0.36
20 0.45
21 0.49
22 0.53
23 0.5
24 0.51
25 0.52
26 0.51
27 0.53
28 0.5
29 0.49
30 0.51
31 0.52
32 0.56
33 0.49
34 0.4
35 0.41
36 0.35
37 0.34
38 0.3
39 0.27
40 0.21
41 0.24
42 0.24
43 0.22
44 0.24
45 0.23
46 0.24
47 0.29
48 0.36
49 0.38
50 0.49
51 0.55
52 0.58
53 0.65
54 0.71
55 0.7
56 0.69
57 0.7
58 0.66
59 0.66
60 0.64
61 0.56
62 0.55
63 0.52
64 0.46
65 0.42
66 0.37
67 0.3
68 0.28
69 0.26
70 0.16
71 0.19
72 0.19
73 0.15
74 0.15
75 0.13
76 0.12
77 0.12
78 0.12
79 0.08
80 0.13
81 0.17
82 0.22
83 0.29
84 0.3
85 0.37
86 0.48
87 0.56
88 0.61
89 0.66
90 0.7
91 0.73
92 0.82
93 0.86
94 0.84
95 0.83
96 0.79
97 0.8
98 0.76
99 0.74
100 0.7
101 0.71
102 0.71