Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EKZ3

Protein Details
Accession A0A059EKZ3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
49-75NNKIIITFKSKKKPSRKNKTRTLFTPHHydrophilic
NLS Segment(s)
PositionSequence
57-67KSKKKPSRKNK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036511  TGT-like_sf  
IPR002616  tRNA_ribo_trans-like  
Gene Ontology GO:0016763  F:pentosyltransferase activity  
GO:0101030  P:tRNA-guanine transglycosylation  
Pfam View protein in Pfam  
PF01702  TGT  
Amino Acid Sequences MDYLISTEQCCVPYILKIETNQPILIYLDDIFEHYQKNTTSINTLMNINNKIIITFKSKKKPSRKNKTRTLFTPHGNRLITEIEYSSLIKVISPFYHEDFNTFVIKNDNESFEYFSPKDFYEAISLLKENKLIDTLFLYDLTKNGKLIIDKDIVSVNDEYTCECCCKSEYLRHLYKLNEINAYITLQRHNLLALDNIVKEIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.25
4 0.26
5 0.31
6 0.35
7 0.36
8 0.32
9 0.29
10 0.26
11 0.23
12 0.22
13 0.17
14 0.12
15 0.1
16 0.1
17 0.12
18 0.12
19 0.12
20 0.13
21 0.12
22 0.16
23 0.16
24 0.19
25 0.19
26 0.19
27 0.2
28 0.21
29 0.22
30 0.2
31 0.22
32 0.22
33 0.25
34 0.26
35 0.23
36 0.23
37 0.2
38 0.19
39 0.18
40 0.17
41 0.2
42 0.26
43 0.34
44 0.42
45 0.5
46 0.59
47 0.69
48 0.77
49 0.8
50 0.84
51 0.87
52 0.87
53 0.9
54 0.9
55 0.87
56 0.81
57 0.79
58 0.73
59 0.68
60 0.68
61 0.6
62 0.56
63 0.49
64 0.44
65 0.36
66 0.32
67 0.27
68 0.18
69 0.15
70 0.1
71 0.11
72 0.11
73 0.09
74 0.08
75 0.07
76 0.06
77 0.07
78 0.07
79 0.07
80 0.09
81 0.11
82 0.11
83 0.14
84 0.14
85 0.14
86 0.14
87 0.16
88 0.15
89 0.14
90 0.13
91 0.13
92 0.13
93 0.15
94 0.15
95 0.14
96 0.14
97 0.14
98 0.17
99 0.15
100 0.19
101 0.17
102 0.16
103 0.17
104 0.15
105 0.16
106 0.13
107 0.14
108 0.12
109 0.13
110 0.13
111 0.12
112 0.12
113 0.12
114 0.12
115 0.13
116 0.1
117 0.1
118 0.1
119 0.09
120 0.1
121 0.1
122 0.11
123 0.1
124 0.11
125 0.11
126 0.1
127 0.11
128 0.14
129 0.13
130 0.12
131 0.12
132 0.14
133 0.14
134 0.16
135 0.19
136 0.18
137 0.18
138 0.19
139 0.2
140 0.18
141 0.2
142 0.18
143 0.14
144 0.13
145 0.13
146 0.13
147 0.12
148 0.13
149 0.12
150 0.12
151 0.13
152 0.13
153 0.18
154 0.23
155 0.3
156 0.37
157 0.45
158 0.51
159 0.54
160 0.56
161 0.52
162 0.55
163 0.52
164 0.48
165 0.41
166 0.35
167 0.33
168 0.3
169 0.3
170 0.25
171 0.2
172 0.19
173 0.18
174 0.18
175 0.17
176 0.17
177 0.16
178 0.15
179 0.15
180 0.16
181 0.18
182 0.17
183 0.18