Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EKI1

Protein Details
Accession A0A059EKI1    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
3-22EISSEKSKYKGKKKMVLEYIHydrophilic
NLS Segment(s)
PositionSequence
10-41KYKGKKKMVLEYIGPKNKRSVTFSKRKKGIMK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR033897  MADS_SRF-like  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000987  F:cis-regulatory region sequence-specific DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
PROSITE View protein in PROSITE  
PS50066  MADS_BOX_2  
CDD cd00266  MADS_SRF_like  
Amino Acid Sequences NEEISSEKSKYKGKKKMVLEYIGPKNKRSVTFSKRKKGIMKKAYELNILTGSQILLLVASESGHVYTFATPKLKPIITDHEYLIQQCLNTPSAEDYNDFRHNKPLQTYPIEKNYEEYFEHKKNTRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.8
4 0.8
5 0.75
6 0.7
7 0.69
8 0.69
9 0.69
10 0.62
11 0.53
12 0.52
13 0.52
14 0.5
15 0.47
16 0.47
17 0.49
18 0.58
19 0.67
20 0.71
21 0.71
22 0.73
23 0.76
24 0.77
25 0.78
26 0.76
27 0.72
28 0.67
29 0.69
30 0.65
31 0.58
32 0.48
33 0.39
34 0.31
35 0.25
36 0.2
37 0.13
38 0.11
39 0.08
40 0.07
41 0.05
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.06
54 0.07
55 0.08
56 0.1
57 0.1
58 0.12
59 0.16
60 0.16
61 0.16
62 0.19
63 0.26
64 0.26
65 0.28
66 0.27
67 0.27
68 0.27
69 0.26
70 0.24
71 0.16
72 0.13
73 0.13
74 0.14
75 0.11
76 0.11
77 0.11
78 0.13
79 0.14
80 0.15
81 0.15
82 0.16
83 0.21
84 0.29
85 0.31
86 0.29
87 0.36
88 0.38
89 0.41
90 0.43
91 0.44
92 0.42
93 0.47
94 0.52
95 0.5
96 0.55
97 0.55
98 0.5
99 0.48
100 0.44
101 0.4
102 0.36
103 0.35
104 0.35
105 0.36
106 0.43