Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EIT2

Protein Details
Accession A0A059EIT2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-89DLIKRDQERKCRRFLKKRLGSLKRSRSKFDBasic
NLS Segment(s)
PositionSequence
68-85RKCRRFLKKRLGSLKRSR
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MLRKKLKSLRVKYKVTPLTGVEQLPRPNQKKRVITDELKNVRAIVSEICGLAPYEKKAVDLIKRDQERKCRRFLKKRLGSLKRSRSKFDQLAELAKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.67
3 0.6
4 0.51
5 0.46
6 0.43
7 0.39
8 0.31
9 0.3
10 0.31
11 0.33
12 0.4
13 0.4
14 0.45
15 0.52
16 0.58
17 0.61
18 0.62
19 0.64
20 0.61
21 0.62
22 0.6
23 0.62
24 0.58
25 0.52
26 0.47
27 0.39
28 0.32
29 0.27
30 0.21
31 0.11
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.06
38 0.07
39 0.08
40 0.08
41 0.09
42 0.09
43 0.1
44 0.11
45 0.15
46 0.19
47 0.23
48 0.27
49 0.34
50 0.39
51 0.44
52 0.47
53 0.54
54 0.61
55 0.6
56 0.65
57 0.66
58 0.72
59 0.78
60 0.83
61 0.84
62 0.82
63 0.88
64 0.89
65 0.87
66 0.87
67 0.86
68 0.87
69 0.85
70 0.8
71 0.76
72 0.73
73 0.74
74 0.71
75 0.64
76 0.62
77 0.55