Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EKG2

Protein Details
Accession A0A059EKG2    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
138-165GSFKNDKELKRKQYGRRYHNNRNQINNSHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 11, cyto 8.5, cyto_nucl 8, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027157  NCBP2  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0005846  C:nuclear cap binding complex  
GO:0005634  C:nucleus  
GO:0000339  F:RNA cap binding  
GO:0045292  P:mRNA cis splicing, via spliceosome  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MVNIFYIQSLIMGLDKYIALKPEEDKYRDRKFVGTEEDYAKALQESTIVYVGRLPEEMSEEAIWFMFSTCGEIKRVIMGINRTTLYPCGFCFVEFYNKESARIACLFDKFVYGGNEISVNIDYGFVNGRQFGRGYFGGSFKNDKELKRKQYGRRYHNNRNQINNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.09
4 0.1
5 0.12
6 0.12
7 0.14
8 0.17
9 0.24
10 0.31
11 0.33
12 0.38
13 0.45
14 0.53
15 0.56
16 0.55
17 0.5
18 0.46
19 0.49
20 0.5
21 0.45
22 0.4
23 0.38
24 0.37
25 0.34
26 0.31
27 0.25
28 0.17
29 0.14
30 0.1
31 0.08
32 0.07
33 0.08
34 0.1
35 0.1
36 0.09
37 0.11
38 0.11
39 0.11
40 0.1
41 0.09
42 0.07
43 0.1
44 0.11
45 0.11
46 0.1
47 0.1
48 0.1
49 0.1
50 0.09
51 0.06
52 0.06
53 0.05
54 0.04
55 0.07
56 0.08
57 0.09
58 0.1
59 0.1
60 0.1
61 0.11
62 0.11
63 0.1
64 0.11
65 0.13
66 0.13
67 0.14
68 0.15
69 0.14
70 0.14
71 0.14
72 0.12
73 0.11
74 0.1
75 0.1
76 0.1
77 0.1
78 0.11
79 0.12
80 0.19
81 0.19
82 0.21
83 0.25
84 0.25
85 0.26
86 0.26
87 0.25
88 0.2
89 0.2
90 0.21
91 0.16
92 0.16
93 0.17
94 0.16
95 0.16
96 0.13
97 0.15
98 0.15
99 0.13
100 0.13
101 0.12
102 0.12
103 0.11
104 0.12
105 0.09
106 0.08
107 0.07
108 0.08
109 0.07
110 0.07
111 0.09
112 0.08
113 0.09
114 0.1
115 0.11
116 0.12
117 0.12
118 0.12
119 0.15
120 0.15
121 0.17
122 0.17
123 0.19
124 0.21
125 0.23
126 0.27
127 0.22
128 0.31
129 0.32
130 0.35
131 0.43
132 0.5
133 0.56
134 0.63
135 0.71
136 0.73
137 0.79
138 0.85
139 0.85
140 0.87
141 0.88
142 0.88
143 0.89
144 0.89
145 0.87