Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ETU8

Protein Details
Accession A0A059ETU8    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
102-123ELKIRKEQIQAQKRREERKKEKBasic
NLS Segment(s)
PositionSequence
97-123KPLKSELKIRKEQIQAQKRREERKKEK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011047  Quinoprotein_ADH-like_supfam  
IPR007287  Sof1  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF04158  Sof1  
PROSITE View protein in PROSITE  
PS50082  WD_REPEATS_2  
Amino Acid Sequences SADTTVKVFDLERKCLDVYHTRRMFRVNGIRLSKNEEFVISGSDDGNLRLWKTNASRKIGIISDNQNRALAYNDALKDKFKYVKEIHRISNQRFLPKPLKSELKIRKEQIQAQKRREERKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.35
4 0.37
5 0.38
6 0.43
7 0.47
8 0.46
9 0.47
10 0.5
11 0.47
12 0.46
13 0.49
14 0.44
15 0.46
16 0.5
17 0.52
18 0.49
19 0.55
20 0.47
21 0.4
22 0.34
23 0.26
24 0.22
25 0.19
26 0.2
27 0.12
28 0.11
29 0.09
30 0.09
31 0.09
32 0.08
33 0.1
34 0.09
35 0.09
36 0.11
37 0.11
38 0.14
39 0.19
40 0.26
41 0.3
42 0.34
43 0.34
44 0.33
45 0.35
46 0.32
47 0.29
48 0.24
49 0.25
50 0.26
51 0.27
52 0.27
53 0.24
54 0.23
55 0.22
56 0.21
57 0.15
58 0.11
59 0.13
60 0.14
61 0.16
62 0.16
63 0.17
64 0.16
65 0.19
66 0.24
67 0.21
68 0.27
69 0.3
70 0.39
71 0.47
72 0.5
73 0.52
74 0.55
75 0.61
76 0.57
77 0.61
78 0.55
79 0.54
80 0.51
81 0.53
82 0.52
83 0.49
84 0.5
85 0.48
86 0.53
87 0.48
88 0.56
89 0.6
90 0.61
91 0.65
92 0.65
93 0.66
94 0.65
95 0.71
96 0.72
97 0.72
98 0.72
99 0.72
100 0.78
101 0.78
102 0.82
103 0.83