Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EJS3

Protein Details
Accession A0A059EJS3    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
104-124NIEKWKKRMSQKKGSVKKENKBasic
NLS Segment(s)
PositionSequence
107-121KWKKRMSQKKGSVKK
Subcellular Location(s) nucl 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000313  PWWP_dom  
Pfam View protein in Pfam  
PF00855  PWWP  
PROSITE View protein in PROSITE  
PS50812  PWWP  
CDD cd05162  PWWP  
Amino Acid Sequences MKYNPNDIVFTMYDEYPPWPSKIAPKEITDEVLARNNTEGIVVMFYGEELSYGVIKSEKDIIPFEQNALPENADEEMKKAYAMAKENTVAFPDLDPPTKKELINIEKWKKRMSQKKGSVKKENKVDEDVKRMKTDVSTENKIKEESGPQKEKKNEIKDIFFNNQEEIKENKISEELKEKIETEMKEEKERNPQKSINSINKEEERAIINDITQNIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.23
5 0.21
6 0.2
7 0.21
8 0.3
9 0.37
10 0.43
11 0.42
12 0.43
13 0.47
14 0.46
15 0.47
16 0.39
17 0.33
18 0.27
19 0.29
20 0.27
21 0.22
22 0.21
23 0.19
24 0.17
25 0.16
26 0.13
27 0.07
28 0.08
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.04
36 0.04
37 0.05
38 0.05
39 0.05
40 0.06
41 0.07
42 0.07
43 0.08
44 0.14
45 0.15
46 0.16
47 0.18
48 0.2
49 0.24
50 0.24
51 0.25
52 0.21
53 0.2
54 0.2
55 0.19
56 0.17
57 0.12
58 0.12
59 0.11
60 0.09
61 0.09
62 0.09
63 0.09
64 0.08
65 0.08
66 0.08
67 0.1
68 0.13
69 0.16
70 0.16
71 0.17
72 0.18
73 0.19
74 0.19
75 0.17
76 0.14
77 0.11
78 0.1
79 0.12
80 0.12
81 0.15
82 0.16
83 0.17
84 0.21
85 0.23
86 0.23
87 0.22
88 0.28
89 0.3
90 0.37
91 0.44
92 0.48
93 0.49
94 0.51
95 0.51
96 0.49
97 0.53
98 0.55
99 0.55
100 0.57
101 0.63
102 0.73
103 0.8
104 0.81
105 0.83
106 0.8
107 0.78
108 0.76
109 0.71
110 0.63
111 0.59
112 0.57
113 0.49
114 0.52
115 0.5
116 0.44
117 0.39
118 0.37
119 0.32
120 0.27
121 0.28
122 0.26
123 0.27
124 0.32
125 0.33
126 0.36
127 0.36
128 0.36
129 0.32
130 0.27
131 0.29
132 0.31
133 0.38
134 0.44
135 0.46
136 0.54
137 0.57
138 0.64
139 0.65
140 0.63
141 0.63
142 0.6
143 0.61
144 0.58
145 0.6
146 0.56
147 0.5
148 0.43
149 0.36
150 0.34
151 0.29
152 0.28
153 0.25
154 0.24
155 0.24
156 0.23
157 0.22
158 0.24
159 0.24
160 0.23
161 0.28
162 0.27
163 0.27
164 0.29
165 0.28
166 0.28
167 0.33
168 0.3
169 0.29
170 0.35
171 0.35
172 0.41
173 0.44
174 0.44
175 0.5
176 0.58
177 0.56
178 0.56
179 0.57
180 0.54
181 0.61
182 0.66
183 0.65
184 0.64
185 0.63
186 0.63
187 0.63
188 0.61
189 0.53
190 0.46
191 0.39
192 0.33
193 0.32
194 0.25
195 0.22
196 0.23