Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EJG4

Protein Details
Accession A0A059EJG4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
48-67TALCPKCCMKSKKTEIRPVFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037381  RFWD3  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR036322  WD40_repeat_dom_sf  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0005634  C:nucleus  
GO:0004842  F:ubiquitin-protein transferase activity  
GO:0036297  P:interstrand cross-link repair  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MDNEEGEDSCPICLCNYTTTGDHKIVSLKCGHLFGKQCIESWFNRRSTALCPKCCMKSKKTEIRPVFASKIIAIDSVKEEETIKELNQERKLRMDLQIENDKLKTTINYLNNELLKKESLKTQTTYNFLHKRLLKKFHTKVNKNSILIYEKMNNVILFSFLENKLGIKKFDANTLKNVEFFGVNDFFTSDFIKDIKPSPFNDGIFGIVYQKFFKLFTSFNNKEAYTFTHDRNLTSFDFDDENRHLIFLGCEDGKVSILNLETNRIIQEIFVASCPIHSICKDNEILYCAGFLGVYKIIEDIIEKVEGRFYPVCTNLFSDGKSILATFRNESMTVMHYLLNTDLFLNLGRIHYRRNRDKIFNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.2
5 0.22
6 0.28
7 0.32
8 0.32
9 0.31
10 0.29
11 0.34
12 0.32
13 0.33
14 0.31
15 0.29
16 0.29
17 0.33
18 0.32
19 0.31
20 0.35
21 0.36
22 0.42
23 0.39
24 0.38
25 0.37
26 0.41
27 0.39
28 0.41
29 0.44
30 0.37
31 0.38
32 0.37
33 0.36
34 0.4
35 0.47
36 0.49
37 0.45
38 0.48
39 0.51
40 0.58
41 0.66
42 0.65
43 0.61
44 0.63
45 0.7
46 0.76
47 0.8
48 0.83
49 0.78
50 0.77
51 0.75
52 0.7
53 0.62
54 0.53
55 0.45
56 0.35
57 0.31
58 0.25
59 0.21
60 0.15
61 0.14
62 0.14
63 0.15
64 0.15
65 0.14
66 0.14
67 0.13
68 0.15
69 0.15
70 0.13
71 0.19
72 0.24
73 0.3
74 0.38
75 0.43
76 0.42
77 0.44
78 0.47
79 0.43
80 0.43
81 0.42
82 0.37
83 0.39
84 0.46
85 0.43
86 0.41
87 0.39
88 0.34
89 0.28
90 0.25
91 0.19
92 0.15
93 0.22
94 0.25
95 0.28
96 0.3
97 0.34
98 0.36
99 0.36
100 0.32
101 0.26
102 0.23
103 0.21
104 0.2
105 0.21
106 0.24
107 0.27
108 0.27
109 0.31
110 0.34
111 0.36
112 0.38
113 0.41
114 0.41
115 0.39
116 0.45
117 0.43
118 0.48
119 0.51
120 0.57
121 0.54
122 0.59
123 0.63
124 0.65
125 0.72
126 0.7
127 0.71
128 0.73
129 0.73
130 0.63
131 0.59
132 0.53
133 0.46
134 0.4
135 0.33
136 0.26
137 0.2
138 0.2
139 0.2
140 0.16
141 0.14
142 0.12
143 0.11
144 0.08
145 0.08
146 0.1
147 0.09
148 0.1
149 0.1
150 0.1
151 0.14
152 0.15
153 0.15
154 0.13
155 0.18
156 0.18
157 0.26
158 0.31
159 0.28
160 0.3
161 0.34
162 0.33
163 0.29
164 0.28
165 0.2
166 0.15
167 0.14
168 0.13
169 0.1
170 0.09
171 0.09
172 0.09
173 0.09
174 0.09
175 0.1
176 0.07
177 0.06
178 0.07
179 0.08
180 0.09
181 0.12
182 0.15
183 0.18
184 0.19
185 0.24
186 0.27
187 0.27
188 0.27
189 0.24
190 0.2
191 0.18
192 0.17
193 0.13
194 0.1
195 0.11
196 0.1
197 0.1
198 0.1
199 0.1
200 0.11
201 0.11
202 0.11
203 0.16
204 0.26
205 0.27
206 0.3
207 0.32
208 0.31
209 0.29
210 0.29
211 0.27
212 0.25
213 0.26
214 0.25
215 0.29
216 0.3
217 0.3
218 0.3
219 0.3
220 0.23
221 0.22
222 0.21
223 0.16
224 0.17
225 0.17
226 0.19
227 0.17
228 0.19
229 0.16
230 0.16
231 0.14
232 0.13
233 0.12
234 0.09
235 0.11
236 0.09
237 0.09
238 0.09
239 0.09
240 0.09
241 0.09
242 0.08
243 0.07
244 0.07
245 0.1
246 0.1
247 0.13
248 0.13
249 0.13
250 0.14
251 0.12
252 0.12
253 0.08
254 0.1
255 0.09
256 0.09
257 0.09
258 0.09
259 0.09
260 0.09
261 0.11
262 0.1
263 0.1
264 0.11
265 0.15
266 0.15
267 0.2
268 0.22
269 0.21
270 0.22
271 0.23
272 0.23
273 0.18
274 0.17
275 0.12
276 0.11
277 0.09
278 0.08
279 0.07
280 0.08
281 0.08
282 0.08
283 0.08
284 0.08
285 0.08
286 0.09
287 0.08
288 0.09
289 0.11
290 0.11
291 0.11
292 0.15
293 0.15
294 0.19
295 0.2
296 0.2
297 0.24
298 0.27
299 0.28
300 0.26
301 0.29
302 0.29
303 0.28
304 0.27
305 0.23
306 0.2
307 0.2
308 0.18
309 0.16
310 0.14
311 0.16
312 0.18
313 0.19
314 0.21
315 0.23
316 0.23
317 0.23
318 0.22
319 0.21
320 0.21
321 0.2
322 0.18
323 0.16
324 0.17
325 0.17
326 0.16
327 0.13
328 0.11
329 0.1
330 0.09
331 0.09
332 0.1
333 0.1
334 0.12
335 0.17
336 0.18
337 0.27
338 0.35
339 0.45
340 0.54
341 0.63
342 0.69